DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and CG11425

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster


Alignment Length:276 Identity:99/276 - (35%)
Similarity:154/276 - (55%) Gaps:35/276 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 KPPLRGPRQIFGRILTDLCLLSCVGLPMLGF-SLWGEAVKRGFFCDDSSLRHPYRDSTMPSWILY 141
            :||:        |:|.||.||..:.:.:..| .|||...||||||||.||.:||.::|:...:|:
  Fly     8 RPPI--------RLLVDLVLLGLLIVLVENFRRLWGPPTKRGFFCDDESLMYPYHENTVSPTLLH 64

  Fly   142 LMCGALPLTVMLVVEFFRGQDKRLHSPFPKSTMCSGYHLCHLELPTWLVECYHRMGIFIFGLGVE 206
            .:...|||..::|:|.|....|.: :|:|               ..|.|  |:.:..|::|....
  Fly    65 WLGLYLPLISLVVLESFLSHRKDM-APWP---------------TLWPV--YNTVRWFLYGYVSN 111

  Fly   207 QLSTNIAKYSIGRLRPHFYTLCQPVMKDGTTCSDPIN--AARYIEEFTCA--AVDITSKQLKDMR 267
            .|...|.|.::|||||||:.:|.|...||::|.|..:  |.:|..::.|.  ....|.:.::|:.
  Fly   112 DLLKGIGKQALGRLRPHFFAVCSPHFPDGSSCLDESHRGALKYHTDYECRPNLSQATEEMIRDVN 176

  Fly   268 LSFPSGHASFACYSMLYLVIYLHRRMQWKQLR--MLCHLLQFLLLMFAWYTALTRVSDYKHHWSD 330
            :||||||::.|.|.::::.::|.|| :| .||  :|..:||...:..||:.|::||.||||||||
  Fly   177 VSFPSGHSAMAFYGLVFVALHLRRR-RW-PLRGSLLSPVLQLACVALAWFVAISRVIDYKHHWSD 239

  Fly   331 VLAGSGIGLTYAVVVT 346
            |.|||.:|...|:.||
  Fly   240 VAAGSLLGAGSALAVT 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 60/160 (38%)
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 61/162 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468185
Domainoid 1 1.000 47 1.000 Domainoid score I11977
eggNOG 1 0.900 - - E1_COG0671
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I1868
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1354951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46697
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10165
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.990

Return to query results.
Submit another query.