DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and CG11426

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster


Alignment Length:279 Identity:111/279 - (39%)
Similarity:171/279 - (61%) Gaps:11/279 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 SLYAVASNKKPPLRGP---RQIFGRILTDLCLLSCVGLPMLGFSLWGEAVKRGFFCDDSSLRHPY 130
            |:.|.||.......||   |::..|:|.:|.::..:.:|:..:....:.|:|||||||.|:.:|:
  Fly    13 SMPASASGSAAGSTGPSSDRRMTQRLLVELLVVVVLVIPICVYEFAVDPVRRGFFCDDESISYPF 77

  Fly   131 RDSTMPSWILYLMCGALPLTVMLVVEFFRGQDKRLHSPFPKSTMCSGYHLCHLELPTWLVECYHR 195
            :|:|:...:|.|:.|.||..||:|||:.        |......:.:...|....:.||.||...:
  Fly    78 QDNTITPVMLGLIVGLLPALVMVVVEYV--------SHLRAGDISATVDLLGWRVSTWYVELGRQ 134

  Fly   196 MGIFIFGLGVEQLSTNIAKYSIGRLRPHFYTLCQPVMKDGTTCSDPINAARYIEEFTCAAVDITS 260
            ...|.|||.:...:|.:.||:||||||||..:|||.:.||:.||||:|..||:|.:.||....|.
  Fly   135 STYFCFGLLLTFDATEVGKYTIGRLRPHFLAVCQPQIADGSMCSDPVNLHRYMENYDCAGEGFTV 199

  Fly   261 KQLKDMRLSFPSGHASFACYSMLYLVIYLHRRMQWKQLRMLCHLLQFLLLMFAWYTALTRVSDYK 325
            :.::..||||||||:|.|.|:|:|:.:||.|::.|:..::..|.:||.::|.||||||:||.|:.
  Fly   200 EDVRQARLSFPSGHSSLAFYAMIYVALYLQRKITWRGSKLSRHFVQFAVVMVAWYTALSRVMDHW 264

  Fly   326 HHWSDVLAGSGIGLTYAVV 344
            |||||||:||.:|:..|::
  Fly   265 HHWSDVLSGSLLGVAGALI 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 73/154 (47%)
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479 73/154 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468187
Domainoid 1 1.000 160 1.000 Domainoid score I4013
eggNOG 1 0.900 - - E1_COG0671
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 202 1.000 Inparanoid score I3720
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1354951at2759
OrthoFinder 1 1.000 - - FOG0000694
OrthoInspector 1 1.000 - - mtm6463
orthoMCL 1 0.900 - - OOG6_100228
Panther 1 1.100 - - P PTHR10165
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X571
109.890

Return to query results.
Submit another query.