DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and CG11437

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_649393.1 Gene:CG11437 / 40470 FlyBaseID:FBgn0037165 Length:305 Species:Drosophila melanogaster


Alignment Length:259 Identity:85/259 - (32%)
Similarity:136/259 - (52%) Gaps:12/259 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 QIFGRILTD-LCLLSCVGLPMLGFSLWGEAVKRGFFCDDSSLRHPYRDSTMPSWILYLMCGALPL 149
            ::..|::.| |.||...|..::.........:|||.|.|:||::|||...:....|.:...|||.
  Fly     8 RLLSRLVIDFLILLGIYGAALVVLPQQLSTAQRGFHCSDTSLKYPYRQPWLTKVHLTIAVVALPA 72

  Fly   150 TVMLVVEFFRGQDKRLHSPFPKST-MCSGYHLCHLELPTWLVECYHRMGIFIFGLGVEQLSTNIA 213
            ..:||||..|.      :..|.|| :...:....:.:|.::.|||..:|:::||||:...:..:.
  Fly    73 AFVLVVEMLRA------AVVPSSTELTQRFVFVGVRIPRFISECYKAIGVYLFGLGLTLAAIRLT 131

  Fly   214 KYSIGRLRPHFYTLCQPV--MKDGTTCSDPI--NAARYIEEFTCAAVDITSKQLKDMRLSFPSGH 274
            |:|.|||||:|:.:|||.  .:.|.:|||..  |:..|:|:|:|.....:...|..:|.|||||.
  Fly   132 KHSTGRLRPYFFDICQPTWGTEGGESCSDVTAQNSTLYLEDFSCTEFAASQDLLALVRHSFPSGF 196

  Fly   275 ASFACYSMLYLVIYLHRRMQWKQLRMLCHLLQFLLLMFAWYTALTRVSDYKHHWSDVLAGSGIG 338
            .|..||:|.:|:.|...|:....||::...||......|......|:|.|::|.:||.||:.:|
  Fly   197 VSTTCYAMGFLIFYSQARLFAPWLRLVRASLQLACCSLALVVCWERISTYQNHLTDVAAGAALG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 56/152 (37%)
CG11437NP_649393.1 PAP2_wunen 109..268 CDD:239479 56/152 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468199
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I1868
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1354951at2759
OrthoFinder 1 1.000 - - FOG0000694
OrthoInspector 1 1.000 - - otm46697
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.