DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and Plpp4

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001074432.1 Gene:Plpp4 / 381925 MGIID:2685936 Length:271 Species:Mus musculus


Alignment Length:227 Identity:64/227 - (28%)
Similarity:93/227 - (40%) Gaps:64/227 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RDSTMPSWILYLMCGALPLTVMLVVEFFRGQDKRLHSPFPKSTMCSGYHLCHLELPTWLVECYHR 195
            :...:|:.:::.:....||.|:.||:..|..||                       |.:.|.:..
Mouse    45 QSDNIPTRLMFAISFLTPLAVICVVKIIRRTDK-----------------------TEIKEAFLA 86

  Fly   196 MGIFIFGLGVEQLSTNIAKYSIGRLRPHFYTLCQP--VMKDGTTCS-DPINAARYIEEFTCAAVD 257
            :.:   .|.:..:.||..|..:||.||.|:..|.|  ||.....|: ||               |
Mouse    87 VSL---ALALNGVCTNTIKLIVGRPRPDFFYRCFPDGVMNSEMRCTGDP---------------D 133

  Fly   258 ITSKQLKDMRLSFPSGHASFAC----YSMLYLVIYLH------RRMQWKQLRMLCHLLQFLLLMF 312
            :.|    :.|.||||.|:|||.    ::..||...||      |...|:    ||..:  |.|..
Mouse   134 LVS----EGRKSFPSIHSSFAFSGLGFTTFYLAGKLHCFTESGRGKSWR----LCAAI--LPLYC 188

  Fly   313 AWYTALTRVSDYKHHWSDVLAGSGIGLTYAVV 344
            |...||:|:.||||||.|...|..|||.:|.:
Mouse   189 AMMIALSRMCDYKHHWQDSFVGGVIGLIFAYI 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 54/167 (32%)
Plpp4NP_001074432.1 PAP2_containing_1_like 37..225 CDD:239484 64/227 (28%)
Phosphatase sequence motif I. /evidence=ECO:0000250|UniProtKB:Q5VZY2 102..110 3/7 (43%)
Phosphatase sequence motif II. /evidence=ECO:0000250|UniProtKB:Q5VZY2 143..146 2/2 (100%)
Phosphatase sequence motif III. /evidence=ECO:0000250|UniProtKB:Q5VZY2 195..205 6/9 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834780
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100228
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3374
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.670

Return to query results.
Submit another query.