DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and CG31717

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001260317.1 Gene:CG31717 / 318911 FlyBaseID:FBgn0051717 Length:204 Species:Drosophila melanogaster


Alignment Length:215 Identity:48/215 - (22%)
Similarity:81/215 - (37%) Gaps:80/215 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 VEFFRGQDKRLHSPFPKSTMCSGYHLCHLELPTWLV------------ECYHRMGIFIFGLGVEQ 207
            :.||:  ..|:||.|.:.: |.|.        .|.|            ..|......:|||.::.
  Fly    29 LSFFK--SLRIHSRFLEIS-CDGI--------AWFVSWIAFIWLLSSKSLYQMQVNMLFGLILDV 82

  Fly   208 LSTNIAKYSIGRLRPHFYTLCQPVMKDGTTCSDPINAARYIEEFTCAAVDITSKQLKDM---RLS 269
            :...:.|..:.|.||                                   :.||.:..:   :.|
  Fly    83 VIVAVLKALVRRRRP-----------------------------------VASKDMLTIGPDKFS 112

  Fly   270 FPSGHASFACYSMLYLV-IY-LHRRMQWKQLRMLCHLLQFLLLMFAW--YTALTRVSDYKHHWSD 330
            |||||||.|.:.:|:.. :| ||              :.||:.:.||  ..|::|:...:|:..|
  Fly   113 FPSGHASRAFFVLLFFAKLYPLH--------------IIFLMPVTAWAVSVAISRLILQRHYILD 163

  Fly   331 VLAGSGIGLTYAVVVTSTMW 350
            :.||:.||:..|::| ..:|
  Fly   164 ICAGAAIGVLEALIV-GLLW 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 36/161 (22%)
CG31717NP_001260317.1 PAP2_containing_2_like 23..179 CDD:239485 47/210 (22%)
PgpB <49..182 CDD:223743 39/190 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.