DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and Plppr3

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_853665.2 Gene:Plppr3 / 314614 RGDID:727823 Length:716 Species:Rattus norvegicus


Alignment Length:286 Identity:74/286 - (25%)
Similarity:126/286 - (44%) Gaps:45/286 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 KKPPLRGPRQIFGRILTDLCLLSC---VGLPMLGFSLWG----------EAVKRGFFCDDSSLRH 128
            ||...:.|:.       .:.||.|   |.||::..|:..          :..|.||.|.|.||..
  Rat     4 KKEKNKTPKD-------SMTLLPCFYFVELPIVASSVVSLYFLELTDLFQPAKVGFQCHDRSLSM 61

  Fly   129 PY---RDSTMPSWILYLMCGALPLTVMLVVEFFRGQ----DKRLHSPFP---KSTMCSGYHLCHL 183
            ||   .:..:|..:|..:..|.|...::|.|   |.    ..||....|   :.::.:|.  |:.
  Rat    62 PYVETNEELIPLLMLLSLAFAAPAASIMVGE---GMVYCLQSRLWGRGPGGVEGSINAGG--CNF 121

  Fly   184 ELPTWLVECYHRMGIFIFGLGVEQLSTNIAKYSIGRLRPHFYTLCQP-VMKDGTTCSDPINAARY 247
            .  ::|......:|:.:|||....|.|::.:.:.|...|.|.|:|:| ....||:|    .|..|
  Rat   122 N--SFLRRTVRFVGVHVFGLCATALVTDVIQLATGYHTPFFLTVCKPNYTLLGTSC----EANPY 180

  Fly   248 IEEFTCAAVDITSKQLKDMRLSFPSGHASFACYSMLYLVIYLHRRMQWKQLRMLCHLLQFLLLMF 312
            |.:..|:..|  :..:...|.:|||.||:.:.::.:|:.:|.:..:. ...::|..:|.|...:.
  Rat   181 ITQDICSGHD--THAILSARKTFPSQHATLSAFAAVYVSMYFNSVIS-DATKLLKPILVFAFAIA 242

  Fly   313 AWYTALTRVSDYKHHWSDVLAGSGIG 338
            |....||:::.|:.|..||.||..||
  Rat   243 AGVCGLTQITQYRSHPVDVYAGFLIG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 42/149 (28%)
Plppr3NP_853665.2 PAP2_wunen 127..276 CDD:239479 42/149 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 311..334
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 416..488
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 548..589
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 664..694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338369
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.