DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and Plppr5

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_038958360.1 Gene:Plppr5 / 310812 RGDID:1309567 Length:344 Species:Rattus norvegicus


Alignment Length:245 Identity:75/245 - (30%)
Similarity:119/245 - (48%) Gaps:39/245 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 RGFFCDDSSLRHPY----RDSTMPSWILYLMCGALPLTVMLVVEF-----------FRGQDKRLH 166
            :||||.||:.|.||    ..|.:|..:||.:...:|:.|::|.|.           |..|:|   
  Rat    41 QGFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEK--- 102

  Fly   167 SPFPKSTMCSGYHLCHLELPTWLVECYHR-MGIFIFGLGVEQLSTNIAKYSIGRLRPHFYTLCQP 230
                  |:.:| ..|::. |  ||....| :||:.|||....:..|..:...|.|.|||..||:|
  Rat   103 ------TILTG-DCCYIN-P--LVRRTVRFLGIYAFGLFATDIFVNAGQVVTGNLAPHFLALCKP 157

  Fly   231 VMKDGTTCSDPINAARYI--EEFTCAAVDITSKQLKDMRLSFPSGHASFACYSMLYLVIYLHRRM 293
                ..|........::|  ||......|:..:    .|.:|||..|:.:.|:.:||.:|:...:
  Rat   158 ----NYTALGCQQYTQFISGEEACTGNPDLIMR----ARKTFPSKEAALSVYAAMYLTMYITNTI 214

  Fly   294 QWKQLRMLCHLLQFLLLMFAWYTALTRVSDYKHHWSDVLAGSGIGLTYAV 343
            :.|..|:...:|...|:..|:.|.|.||::|::|||||:||..:|::.||
  Rat   215 KAKGTRLAKPVLCLGLMCLAFLTGLNRVAEYRNHWSDVIAGFLVGISIAV 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 49/156 (31%)
Plppr5XP_038958360.1 PAP2_wunen 118..267 CDD:239479 49/155 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338355
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.