DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and Plpp4

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_038934456.1 Gene:Plpp4 / 309014 RGDID:1306289 Length:273 Species:Rattus norvegicus


Alignment Length:214 Identity:59/214 - (27%)
Similarity:85/214 - (39%) Gaps:65/214 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RDSTMPSWILYLMCGALPLTVMLVVEFFRGQDKRLHSPFPKSTMCSGYHLCHLELPTWLVECYHR 195
            :...:|:.:::.:....||.|:.||:..|..||                       |.:.|.:  
  Rat    45 QSDNIPTRLMFAISFLTPLAVICVVKIIRRTDK-----------------------TEIKEAF-- 84

  Fly   196 MGIFIFGLGVEQLSTNIAKYSIGRLRPHFYTLCQP--VMKDGTTCS-DPINAARYIEEFTCAAVD 257
              :....|.:..:.||..|..:||.||.|:..|.|  ||.....|: ||               |
  Rat    85 --LVSLALALNGVCTNTIKLIVGRPRPDFFYRCFPDGVMNSEMHCTGDP---------------D 132

  Fly   258 ITSKQLKDMRLSFPSGHASFAC----YSMLYLVIYLH------RRMQWKQLRMLCHLLQFLLLMF 312
            :.|    :.|.||||.|:|||.    ::..||...||      |...|:    ||..:  |.|..
  Rat   133 LVS----EGRKSFPSIHSSFAFSGLGFTTFYLAGKLHCFTESGRGKSWR----LCAAI--LPLYC 187

  Fly   313 AWYTALTRVSDYKHHWSDV 331
            |...||:|:.||||||..|
  Rat   188 AMMIALSRMCDYKHHWQAV 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 49/154 (32%)
Plpp4XP_038934456.1 PAP2_containing_1_like 37..206 CDD:239484 58/212 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338362
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100228
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.640

Return to query results.
Submit another query.