DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and Sgpp2

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001178740.1 Gene:Sgpp2 / 301543 RGDID:1565739 Length:354 Species:Rattus norvegicus


Alignment Length:174 Identity:37/174 - (21%)
Similarity:65/174 - (37%) Gaps:45/174 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 YHLCHLELPTWLVECY---HRMGIFIFGLGVEQLSTNIAKYSIGRLRPHFYTLCQPVMKDGTTCS 239
            :::..|....|.::.|   ..:.|::..:.:.|::.:|.|:.    ||.    ..||:|      
  Rat    56 FYITFLPFTHWNIDPYLSRRLVVIWVLVMYIGQVAKDILKWP----RPS----SPPVVK------ 106

  Fly   240 DPINAARYIEEFTCAAVDITSKQLKDMRLSFPSGHASFACYSMLYLVIYLHRRMQWKQLRMLCHL 304
               ...|.|.|:                 ..||.||..|......|:|....|.|:..:..|   
  Rat   107 ---LEKRVIAEY-----------------GMPSTHAMAATAISFTLLISTMDRYQYPFILGL--- 148

  Fly   305 LQFLLLMFAWYTALTRVSDYKHHWSDVLAGSGIGLTYAVVVTST 348
              .:.::|:...:|:|:....|...|||.|.   |..||::..|
  Rat   149 --IMAVVFSTLVSLSRLYTGMHTVLDVLGGV---LITAVLIALT 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 34/157 (22%)
Sgpp2NP_001178740.1 PAP2_SPPase1 39..188 CDD:239482 37/174 (21%)
PgpB <40..191 CDD:223743 37/174 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.