DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and Plppr4

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001001508.2 Gene:Plppr4 / 295401 RGDID:727806 Length:766 Species:Rattus norvegicus


Alignment Length:296 Identity:85/296 - (28%)
Similarity:136/296 - (45%) Gaps:45/296 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 GPRQIF---------GRILTD-LCLLSC---VGLPMLGFSLWG----------EAVKRGFFCDDS 124
            |.||:.         |:::.| :.||.|   |.||:|..|:..          :.|..||.|.|.
  Rat    43 GARQVAGMSAKERPKGKVIKDSVTLLPCFYFVELPILASSVVSLYFLELTDVFKPVHSGFSCYDR 107

  Fly   125 SLRHPYRDST---MPSWILYLMCGALPLTVMLVVE--FFRGQDKRLHSPFPKSTMCSGYHLCHLE 184
            ||..||.:.|   :|..:|..:..|.|...::|.|  .:....||.:....:..:.:|.  |:..
  Rat   108 SLSMPYIEPTQEAIPFLMLLSLAFAGPAITIMVGEGILYCCLSKRRNGAGLEPNINAGG--CNFN 170

  Fly   185 LPTWLVECYHRMGIFIFGLGVEQLSTNIAKYSIGRLRPHFYTLCQPVMKDGTTCSDPINAARYIE 249
              ::|......:|:.:|||....|.|:|.:.|.|...|:|.|:|:|   :.|:.:.......||.
  Rat   171 --SFLRRAVRFVGVHVFGLCSTALITDIIQLSTGYQAPYFLTVCKP---NYTSLNVSCKENSYIV 230

  Fly   250 EFTCAAVDITSKQLKDMRLSFPSGHASFACYSMLYLVIYLHRRMQWKQLRMLCHLLQFLLLMFAW 314
            |..|:..|:|  .:...|.||||.||:.|.::.:|:.:|.:..:. ...::|..||.|..::...
  Rat   231 EDICSGSDLT--VINSGRKSFPSQHATLAAFAAVYVSMYFNSTLT-DSSKLLKPLLVFTFIICGI 292

  Fly   315 YTALTRVSDYKHHWSDV----LAGSGIGL---TYAV 343
            ...|||::.||:|..||    |.|.||.|   .|||
  Rat   293 ICGLTRITQYKNHPVDVYCGFLIGGGIALYLGLYAV 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 51/160 (32%)
Plppr4NP_001001508.2 PAP2_wunen 175..324 CDD:239479 48/154 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 454..503
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 510..529
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 634..654
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 672..705
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 741..766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338340
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.