DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and Plppr1

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_848871.1 Gene:Plppr1 / 272031 MGIID:2445015 Length:325 Species:Mus musculus


Alignment Length:240 Identity:71/240 - (29%)
Similarity:109/240 - (45%) Gaps:29/240 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 RGFFCDDSSLRHPY----RDSTMPSWILYLMCGALPLTVMLVVEFFRGQDKRLHSPFPKST---- 173
            :||||.|..|..||    .:|.:...:||.:..|.|..::.:.|        :...|.|||    
Mouse    46 QGFFCQDGDLMKPYPGTEEESFISPLVLYCVLAATPTAIIFIGE--------ISMYFIKSTRESL 102

  Fly   174 -----MCSGYHLCHLELPTWLVECYHRMGIFIFGLGVEQLSTNIAKYSIGRLRPHFYTLCQPVMK 233
                 |......|:|.  ..|......:|:|.|||....:..|..:...|.|.|:|.|:|||   
Mouse   103 IAEEKMILTGDCCYLS--PLLRRIIRFIGVFAFGLFATDIFVNAGQVVTGHLTPYFLTVCQP--- 162

  Fly   234 DGTTCSDPINAARYIEEFTCAAVDITSKQLKDMRLSFPSGHASFACYSMLYLVIYLHRRMQWKQL 298
             ..|.:|.....::|........|:  :.::..|.||||.||:.:.||.||..:|:...::.|..
Mouse   163 -NYTSTDCRAHQQFINNGNICTGDL--EVIEKARRSFPSKHAALSIYSALYATMYITSTIKTKSS 224

  Fly   299 RMLCHLLQFLLLMFAWYTALTRVSDYKHHWSDVLAGSGIGLTYAV 343
            |:...:|....|..|:.|.|.|||:|::|.|||:||..:|...|:
Mouse   225 RLAKPVLCLGTLCTAFLTGLNRVSEYRNHCSDVIAGFILGTAVAL 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 49/153 (32%)
Plppr1NP_848871.1 PAP2_wunen 123..272 CDD:239479 49/153 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834766
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.