DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and Plppr4

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_808332.3 Gene:Plppr4 / 229791 MGIID:106530 Length:766 Species:Mus musculus


Alignment Length:281 Identity:82/281 - (29%)
Similarity:132/281 - (46%) Gaps:36/281 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GRILTD-LCLLSC---VGLPMLGFSLWG----------EAVKRGFFCDDSSLRHPYRDST---MP 136
            |:::.| :.||.|   |.||:|..|:..          :.|..||.|.|.||..||.:.|   :|
Mouse    58 GKVIKDSVTLLPCFYFVELPILASSVVSLYFLELTDVFKPVHSGFSCYDRSLSMPYIEPTQEAIP 122

  Fly   137 SWILYLMCGALPLTVMLVVE--FFRGQDKRLHSPFPKSTMCSGYHLCHLELPTWLVECYHRMGIF 199
            ..:|..:..|.|...::|.|  .:....||.:....:..:.:|.  |:..  ::|......:|:.
Mouse   123 FLMLLSLAFAGPAITIMVGEGILYCCLSKRRNGAGLEPNINAGG--CNFN--SFLRRAVRFVGVH 183

  Fly   200 IFGLGVEQLSTNIAKYSIGRLRPHFYTLCQPVMKDGTTCSDPINAARYIEEFTCAAVDITSKQLK 264
            :|||....|.|:|.:.|.|...|:|.|:|:|   :.|:.:.......||.|..|:..|:|  .:.
Mouse   184 VFGLCSTALITDIIQLSTGYQAPYFLTVCKP---NYTSLNVSCKENSYIVEDICSGSDLT--VIN 243

  Fly   265 DMRLSFPSGHASFACYSMLYLVIYLHRRMQWKQLRMLCHLLQFLLLMFAWYTALTRVSDYKHHWS 329
            ..|.||||.||:.|.::.:|:.:|.:..:. ...::|..||.|..::......|||::.||:|..
Mouse   244 SGRKSFPSQHATLAAFAAVYVSMYFNSTLT-DSSKLLKPLLVFTFIICGIICGLTRITQYKNHPV 307

  Fly   330 DV----LAGSGIGL---TYAV 343
            ||    |.|.||.|   .|||
Mouse   308 DVYCGFLIGGGIALYLGLYAV 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 51/160 (32%)
Plppr4NP_808332.3 PAP2_wunen 175..324 CDD:239479 48/154 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 454..494
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 634..654
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 672..701
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 742..766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834758
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.