DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and SGPP2

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_689599.2 Gene:SGPP2 / 130367 HGNCID:19953 Length:399 Species:Homo sapiens


Alignment Length:176 Identity:36/176 - (20%)
Similarity:64/176 - (36%) Gaps:43/176 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 YHLCHLELPTWLVECY---HRMGIFIFGLGVEQLSTNIAKYSIGRLRPHFYTLCQPVMKDGTTCS 239
            :::..|....|.::.|   ..:.|::..:.:.|::.::.|:.    ||.    ..||:|      
Human   101 FYITFLPFTHWNIDPYLSRRLIIIWVLVMYIGQVAKDVLKWP----RPS----SPPVVK------ 151

  Fly   240 DPINAARYIEEFTCAAVDITSKQLKDMRLSFPSGHASFACYSMLYLVIYLHRRMQWKQLRMLCHL 304
               ...|.|.|:                 ..||.||..|......|:|....|.|:..:..|   
Human   152 ---LEKRLIAEY-----------------GMPSTHAMAATAIAFTLLISTMDRYQYPFVLGL--- 193

  Fly   305 LQFLLLMFAWYTALTRVSDYKHHWSDVLAGSGIGLTYAVVVTSTMW 350
              .:.::|:....|:|:....|...|||.|..| ....:|:|...|
Human   194 --VMAVVFSTLVCLSRLYTGMHTVLDVLGGVLI-TALLIVLTYPAW 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 32/157 (20%)
SGPP2NP_689599.2 PAP2_SPPase1 84..233 CDD:239482 34/171 (20%)
Phosphatase sequence motif I. /evidence=ECO:0000305 136..144 1/11 (9%)
Phosphatase sequence motif II. /evidence=ECO:0000305 163..166 2/2 (100%)
Phosphatase sequence motif III. /evidence=ECO:0000305 206..217 2/10 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.