DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and AgaP_AGAP001941

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_321121.5 Gene:AgaP_AGAP001941 / 1281183 VectorBaseID:AGAP001941 Length:333 Species:Anopheles gambiae


Alignment Length:224 Identity:66/224 - (29%)
Similarity:101/224 - (45%) Gaps:54/224 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 RHPYRDSTMPSWILYLMCGALPLTVMLVVEFFRGQDKRLHSPFPKSTMCSGYHLCHLELPTWLVE 191
            |:|..||.:|..:|:.:...:| .:...:.:.|.:|::                   ||...:: 
Mosquito    66 RNPRTDSYVPLTMLWPIVLGVP-GLAFTLHYLRTRDRQ-------------------ELRCTVL- 109

  Fly   192 CYHRMGIFIFGLGVEQLSTNIAKYSIGRLRPHFYTLCQPVMKDGTTCSDPINAARYIEEFTCAAV 256
                  .|..|||:..:.||..|.::||.||.|:..|.|   ||.     :|     :|..|...
Mosquito   110 ------AFTLGLGLNGVITNTVKIAVGRPRPDFFWRCFP---DGV-----LN-----DELHCTGK 155

  Fly   257 DITSKQLKDMRLSFPSGHASFACYSMLYLVIYL-------HRRMQWKQLRMLCHLLQFLLLMFAW 314
            |:  :.|.|.|.||||||:|||...:.:|..||       :.|.:.:.:|::.   ..|.|..|.
Mosquito   156 DM--RALIDGRKSFPSGHSSFAFVGLGFLTWYLIGKLHLMNERGRGRSVRVIA---AGLPLFAAT 215

  Fly   315 YTALTRVSDYKHHWSDVLAGS--GIGLTY 341
            ..|::|..||.|||.||..||  ||.|:|
Mosquito   216 MIAISRTCDYHHHWQDVTVGSLIGIVLSY 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 55/160 (34%)
AgaP_AGAP001941XP_321121.5 PAP2_containing_1_like 63..250 CDD:239484 66/224 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.