DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment wun2 and xdh

DIOPT Version :9

Sequence 1:	NP_524991.1	Gene:	wun2 / 53558	FlyBaseID:	FBgn0041087	Length:	350	Species:	Drosophila melanogaster
Sequence 2:	XP_031758260.1	Gene:	xdh / 100497499	XenbaseID:	XB-GENE-956800	Length:	1335	Species:	Xenopus tropicalis

Alignment Length:	54	Identity:	16/54 - (29%)
Similarity:	25/54 - (46%)	Gaps:	17/54 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly    14 PLQR-FESQSSSGEEP-SSPTASSIIAAASG---------------PNHNNNNN 50
            |..| |.|::|:...| :||||:|:.:..:|               |..|:|.|
Frog  1063 PTSRIFISETSTNTVPNTSPTAASVSSDLNGMAIFNACQKILQRLEPYRNSNPN 1116

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
wun2	NP_524991.1	PAP2_wunen	191..346	CDD:239479
xdh	XP_031758260.1	PLN02906	28..1318	CDD:215491	16/54 (30%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165164161
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930