DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and slc33a1

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_002933291.1 Gene:slc33a1 / 100494967 XenbaseID:XB-GENE-971528 Length:538 Species:Xenopus tropicalis


Alignment Length:256 Identity:48/256 - (18%)
Similarity:83/256 - (32%) Gaps:84/256 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 LLSCVGLP-MLGFSLWGEAVKRGFFCDDSSLRHPYRDSTMPSWILYLMC-GALPLTVM--LVVEF 157
            |||.|.:| :|.|.:.....|.||...|:.......:..:|...|.|:. ..:||.::  |::..
 Frog   288 LLSIVRMPAVLQFCILLLTAKIGFSAADAVTGLKLIERGVPKEHLALLAVPMVPLQILLPLIISK 352

  Fly   158 FRGQDKRLH-----SPF---------------PKSTMCSGYHLCHLELPTWLVECYHRMGIFIFG 202
            :....|.|:     .||               |:.:..||:.| :..|...|....|::.::...
 Frog   353 YTAGPKPLNVFHKAIPFRLLMGLFFALLVWWTPRVSHESGFPL-YYYLVLLLSYALHQIALYSMF 416

  Fly   203 LGVEQLSTNIAKYSIGRLRPHFYTLCQPV------------------------------------ 231
            :.:...:..::...||..   :.||...|                                    
 Frog   417 VAIMAFNAKVSDPLIGGT---YMTLLNTVSNLGGNWPATVALWMVDPLTSKECVGADGHSCVDHD 478

  Fly   232 -----MKDGTTCSDPINAARYIEEFTCAAVDI--------TSKQLKDMRLSFPSGHASFAC 279
                 :|.|.||...|: ..|:|...|..|..        ..|:|:|      .|.:|:.|
 Frog   479 VAELCIKSGGTCVTLID-GYYVESIVCVVVGFCWWFFFGPRLKKLQD------EGQSSWKC 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 21/138 (15%)
slc33a1XP_002933291.1 MFS 63..531 CDD:391944 47/253 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165164169
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.