DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and plppr5

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_002933846.2 Gene:plppr5 / 100491270 XenbaseID:XB-GENE-983941 Length:314 Species:Xenopus tropicalis


Alignment Length:260 Identity:74/260 - (28%)
Similarity:120/260 - (46%) Gaps:61/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 RGFFCDDSSLRHPY----RDSTMPSWILYLMCGALPLTVMLVVEF-----------FRGQDKRLH 166
            :||||.|||...||    ..|.:|..:|..:...:|:.|::|.|.           |..|:|   
 Frog    39 QGFFCYDSSYTKPYPGPDESSDIPPVLLLSLVTGVPVLVIIVGETVVFCLQVATRDFENQEK--- 100

  Fly   167 SPFPKSTMCSGYHLCHLELPTWLVECYHR-MGIFIFGLGVEQLSTNIAKYSIGRLRPHFYTLCQP 230
                  |:.:| ..|::. |  ||....| :||:.|||....:..|..:...|.|.|||.|:|:|
 Frog   101 ------TLLTG-DCCYIN-P--LVRRTVRFLGIYTFGLFATDIFVNAGQVVTGNLAPHFLTVCKP 155

  Fly   231 ------------VMKDGTTCS-DPINAARYIEEFTCAAVDITSKQLKDMRLSFPSGHASFACYSM 282
                        .:.|...|: :|               |:..|    .|.:|||..|:.:.|:.
 Frog   156 NYTALGCQQFTQFITDANACTGNP---------------DLVIK----ARRTFPSKDAALSVYAA 201

  Fly   283 LYLVIYLHRRMQWKQLRMLCHLLQFLLLMFAWYTALTRVSDYKHHWSDVLAGSGIGLTYAVVVTS 347
            |||.:|:...::.|..|:...:|...|:..|:.|.:.||::|::|||||:||..||::.|:.:.:
 Frog   202 LYLAMYITSTIKAKGTRLAKPVLCLGLMCLAFLTGINRVAEYRNHWSDVIAGFLIGISIAIFLVA 266

  Fly   348  347
             Frog   267  266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 49/168 (29%)
plppr5XP_002933846.2 PAP2_wunen 116..265 CDD:239479 49/167 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.