DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and plpp4

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_002937854.2 Gene:plpp4 / 100487728 XenbaseID:XB-GENE-6051164 Length:271 Species:Xenopus tropicalis


Alignment Length:222 Identity:59/222 - (26%)
Similarity:88/222 - (39%) Gaps:58/222 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RDSTMPSWILYLMCGALPLTVMLVVEFFRGQDKRLHSPFPKSTMCSGYHLCHLELPTWLVECYHR 195
            :...:|:.:::.:....||.|:.||:.....|:                       |.:.|....
 Frog    45 QSDNIPTRLMFAISFLTPLAVIFVVKIILRTDR-----------------------TEVKEACLA 86

  Fly   196 MGIFIFGLGVEQLSTNIAKYSIGRLRPHFYTLCQPVMKDGTTCSDPINAARYIEEFTCAAVDITS 260
            :.:   .|.:..:.||..|..:||.||.|:..|.|   ||.:          .||..|..   .:
 Frog    87 VSL---ALALNGVCTNTIKLIVGRPRPDFFYRCFP---DGVS----------NEEMHCTG---DA 132

  Fly   261 KQLKDMRLSFPSGHASFAC----YSMLYLVIYLH------RRMQWKQLRMLCHLLQFLLLMFAWY 315
            ..:.:.|.||||.|:|||.    ::..||...||      :...|:    ||..:  |.|..|..
 Frog   133 SLVSEGRKSFPSIHSSFAFAGLGFTSFYLAGKLHCFTELGQGKSWR----LCAAI--LPLYCAMM 191

  Fly   316 TALTRVSDYKHHWSDVLAGSGIGLTYA 342
            .||:|:.||||||.|...|..|||..|
 Frog   192 IALSRMCDYKHHWQDSFVGGVIGLILA 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 51/162 (31%)
plpp4XP_002937854.2 PAP2_containing_1_like 37..225 CDD:239484 59/222 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.