DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and plpp4

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_002664129.3 Gene:plpp4 / 100334794 ZFINID:ZDB-GENE-081107-53 Length:286 Species:Danio rerio


Alignment Length:230 Identity:62/230 - (26%)
Similarity:97/230 - (42%) Gaps:61/230 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 RHPYRDST-MPSWILYLMCGALPLTVMLVVEFFRGQDKRLHSPFPKSTMCSGYHLCHLELPTWLV 190
            ::|..:|. :|..:::.:....||.|:.||:..:..|:                       |.:.
Zfish    51 KNPLVESDHIPKRVMFAISFLTPLAVIFVVKIIQRTDR-----------------------TEIK 92

  Fly   191 ECYHRMGIFIFGLGVEQLSTNIAKYSIGRLRPHFYTLCQPVMKDGTTCSDPINAARYIEEFTCAA 255
            |....:.:   .|.:..:.||..|..:||.||.:|..|.|   ||     .:||     :..|..
Zfish    93 EACLAVSL---ALALNGVFTNTIKLIVGRPRPDYYQRCFP---DG-----QMNA-----KMLCTG 141

  Fly   256 -VDITSKQLKDMRLSFPSGHASFACYSMLYLVIYLHRRMQ----------WKQLRMLCHLLQFLL 309
             .|:.|    :.|.||||.|:|||...:.:...||..::|          |:    ||.::  |.
Zfish   142 EPDLVS----EGRKSFPSSHSSFAFSGLGFTSFYLAGKLQCFTDAGRGRSWR----LCAMV--LP 196

  Fly   310 LMFAWYTALTRVSDYKHHWSDVLAGSGIGLTYAVV 344
            |..|...||:|:.||||||.|...|..|||.:|.:
Zfish   197 LYSAMMIALSRICDYKHHWQDAFVGGVIGLFFAYI 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 52/165 (32%)
plpp4XP_002664129.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577839
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100228
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.