DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and sgpp2

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001373215.1 Gene:sgpp2 / 100330698 ZFINID:ZDB-GENE-120221-2 Length:415 Species:Danio rerio


Alignment Length:234 Identity:43/234 - (18%)
Similarity:71/234 - (30%) Gaps:82/234 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 HPYRDSTMPSWILYLMCGALPLTVMLVVEFFRGQD-------KRLH---SPFPKSTMCSGYHLCH 182
            ||.....:.:|:.|.         :.|.....|.:       ..:|   .||          ||.
Zfish    86 HPRPHYVVKNWLFYF---------LFVTSATLGHEIFYITFLPCIHWNLDPF----------LCR 131

  Fly   183 LELPTWLVECYHRMGIFIFGLGVEQLSTNIAKYSIGRLRPHFYTLCQPVMKDGTTCSDPINAARY 247
            ..:..|:|..|           :.|:..::.|..    ||.    ..||:|..|..         
Zfish   132 RLVNMWVVVMY-----------IGQVMKDVLKLP----RPP----SPPVVKLETRV--------- 168

  Fly   248 IEEFTCAAVDITSKQLKDMRLSFPSGHASFACYSMLYLVIYLHRRMQWK-QLRMLCHLLQFLLLM 311
                             |.....||.||..|......|::....|:|:. :|.:...:|..:|: 
Zfish   169 -----------------DAEYGMPSTHAMAATAISFTLLLSAEERVQFPFELGLAVAVLMSVLV- 215

  Fly   312 FAWYTALTRVSDYKHHWSDVLAGSGIGLTYAVVVTSTMW 350
                 .|:|:....|...||:.|..|. .:.:.|:...|
Zfish   216 -----CLSRLYTGMHSALDVICGVAIS-AFIIAVSYPYW 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 28/155 (18%)
sgpp2NP_001373215.1 PAP2_SPPase1 96..243 CDD:239482 39/217 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.