DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and plpp5

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001121478.1 Gene:plpp5 / 100158576 XenbaseID:XB-GENE-5812193 Length:266 Species:Xenopus tropicalis


Alignment Length:277 Identity:77/277 - (27%)
Similarity:108/277 - (38%) Gaps:81/277 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 RILTDLCLLSCVGLPMLGFSLWGEAVKRGFFCDDSSLRHPYRDSTMPS--WIL---YLMCGALP- 148
            |||........:.|.:||..|..|.:            ||:.....|.  |:.   |::...:| 
 Frog     4 RILEGFVAEFIIRLLLLGIFLISETM------------HPFERLIQPEEMWLYRNPYVVSDRVPT 56

  Fly   149 --------LTVMLVVEFFRGQDKRLHSPFPKSTMCSGYHLCHLELPTWLVECYHRMGIFIFGLGV 205
                    ||.:|||...|...|..::...::.:.:...|.             ..|||      
 Frog    57 NSMFLISFLTPLLVVVLARVFWKADNTDAREAGLAASLSLA-------------LNGIF------ 102

  Fly   206 EQLSTNIAKYSIGRLRPHFYTLCQPVMKDGTTCSDPINAARYIEEFTCAAVDITSKQLKDMRLSF 270
                ||..|..:||.||.|.:.|.|   ||          |...||.|..   ..:.:.:.|.||
 Frog   103 ----TNTVKLIVGRPRPDFLSRCFP---DG----------RESPEFHCTG---DPELVIEGRKSF 147

  Fly   271 PSGHASFACYSMLYLVIYLHRRMQ----------WKQLRMLCHLLQFLLLMFAWYTALTRVSDYK 325
            ||||||||...:.:..:||..:::          |:    ||..|..||...|  .||:|..|||
 Frog   148 PSGHASFAFAGLGFTALYLAGKLRCFSSYGRGHSWR----LCTSLIPLLCAIA--IALSRTCDYK 206

  Fly   326 HHWSDVLAGSGIGLTYA 342
            |||.||:.|:.|||.:|
 Frog   207 HHWQDVVVGAFIGLFFA 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 55/162 (34%)
plpp5NP_001121478.1 PAP2_containing_1_like 42..230 CDD:239484 66/227 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3374
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.