DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and plppr3

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001120260.1 Gene:plppr3 / 100145312 XenbaseID:XB-GENE-990099 Length:704 Species:Xenopus tropicalis


Alignment Length:298 Identity:75/298 - (25%)
Similarity:131/298 - (43%) Gaps:45/298 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VASNKKPPLRGPRQIFGRILTDLCLLSC---VGLPMLGFSLWG----------EAVKRGFFCDDS 124
            :.:..|..:|.|:.       .:.||.|   |.||::..|:..          ...:.||.|.|.
 Frog     2 ITNKDKSKVRPPKD-------SMTLLPCFYFVELPIVASSIVSLYFLELTDIFRPAQGGFQCHDR 59

  Fly   125 SLRHPYRDST---MPSWILYLMCGALPLTVMLVVE--FFRGQDKRLHSPFPKSTMCSGYHLCHLE 184
            :|..||.:|.   :|..:|..:..|.|...::|.|  .:..|.|.......:.::.:|.  |:..
 Frog    60 ALSMPYVESNEELIPLLMLLSLAFAAPAASIMVGEGVLYCIQSKLKGRSSSEGSINAGG--CNFN 122

  Fly   185 LPTWLVECYHRMGIFIFGLGVEQLSTNIAKYSIGRLRPHFYTLCQP-VMKDGTTC-SDPINAARY 247
              ::|......:|:.:|||....|.|::.:.:.|...|.|.|:|:| ..:.||:| |:|     |
 Frog   123 --SFLRRTVRFVGVHVFGLCATALVTDVIQLATGYHAPFFLTVCKPNYTRLGTSCASNP-----Y 180

  Fly   248 IEEFTCAAVDITSKQLKDMRLSFPSGHASFACYSMLYLVIYLHRRMQWKQLRMLCHLLQFLLLMF 312
            |.:..|...|  ...:...|.:|||.||:.:.::.:|:.:|.:..:. ...::|..||.|.....
 Frog   181 ITQDICTGND--QHAILSARKTFPSQHATLSAFAAVYISMYFNSIIS-DSTKLLKPLLVFSFSFA 242

  Fly   313 AWYTALTRVSDYKHH----WSDVLAGSGIG--LTYAVV 344
            |....||:::.|:.|    :|..|.|:||.  |.|..|
 Frog   243 AGVCGLTQITQYRSHPVDVYSGFLIGAGIAAYLAYHAV 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 46/162 (28%)
plppr3NP_001120260.1 PAP2_wunen 127..276 CDD:239479 43/156 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.