powered by:
Protein Alignment wun2 and odad3
DIOPT Version :9
Sequence 1: | NP_524991.1 |
Gene: | wun2 / 53558 |
FlyBaseID: | FBgn0041087 |
Length: | 350 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_004918954.1 |
Gene: | odad3 / 100145237 |
XenbaseID: | XB-GENE-877178 |
Length: | 562 |
Species: | Xenopus tropicalis |
Alignment Length: | 63 |
Identity: | 14/63 - (22%) |
Similarity: | 27/63 - (42%) |
Gaps: | 17/63 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 204 GVEQLSTNIAKYSIGRLRPHFYTLCQPVMKDGTTCSDPINAARYIEEFTCAAVDITSKQLKDM 266
|||.|::.:....:.:: :|..| ||:..|| |.....:.||.::|:.:
Frog 426 GVEHLASKVKHIKVPKV--YFPAL------DGSPLSD---------EQVLDLMGITEEKLQKL 471
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
wun2 | NP_524991.1 |
PAP2_wunen |
191..346 |
CDD:239479 |
14/63 (22%) |
odad3 | XP_004918954.1 |
Smc |
14..>290 |
CDD:224117 |
|
DUF3584 |
<132..>477 |
CDD:378817 |
14/63 (22%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165164193 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR10165 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.