DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and plpp6

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001096415.1 Gene:plpp6 / 100125020 XenbaseID:XB-GENE-5871301 Length:275 Species:Xenopus tropicalis


Alignment Length:153 Identity:34/153 - (22%)
Similarity:66/153 - (43%) Gaps:45/153 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 IFGLGVEQLSTNIAKYSIGRLRP-HFYTLCQPVMKDGTTCSDPINAARYIEEFTCAAVDITSKQL 263
            :|.|.::.:...|.|..:.|.|| |                      ..::.|...:||      
 Frog   154 LFALLLDLVLVGIVKGIVKRRRPIH----------------------NRMDMFATFSVD------ 190

  Fly   264 KDMRLSFPSGHASFACYSMLYLVIYLHRRMQWKQLRMLCHLLQFLLLMFAWYTALTRVSDYKHHW 328
               :.|||||||:.|.....:::.:|          :|...::.|::::|...:|:||...:|:.
 Frog   191 ---KYSFPSGHATRAAMVSRFMLNHL----------VLAVPVRILVMLWAIVVSLSRVMLGRHNV 242

  Fly   329 SDVLAGSGIG-LTYAVVVTSTMW 350
            :|||.|..:| :.|:::  ..:|
 Frog   243 TDVLFGFFMGHMQYSLI--EYLW 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 33/147 (22%)
plpp6NP_001096415.1 PAP2_containing_2_like 102..260 CDD:239485 33/148 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.