DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and gpnmb

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001124514.1 Gene:gpnmb / 100124325 XenbaseID:XB-GENE-983263 Length:587 Species:Xenopus tropicalis


Alignment Length:60 Identity:17/60 - (28%)
Similarity:27/60 - (45%) Gaps:2/60 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 KRGFFCDDSSLRHPYRDSTMPSWILYLMCGALPL-TVMLVVEFFRGQDKRLHSPFPKSTM 174
            :|.|.....:|...|:.|...|.:|.|....:.. |.||.|..:|...|: |.|..|:::
 Frog   168 RRNFIYIFQTLGQYYQQSGGSSALLSLNTTNITAGTQMLEVSVYRRGHKQ-HYPVTKASL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479
gpnmbNP_001124514.1 PKD 258..316 CDD:238084
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.