DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and plppr5b

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_021325770.1 Gene:plppr5b / 100093705 ZFINID:ZDB-GENE-070620-15 Length:351 Species:Danio rerio


Alignment Length:243 Identity:68/243 - (27%)
Similarity:119/243 - (48%) Gaps:30/243 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 RGFFCDDSSLRHPY----RDSTMPSWILYLMCGALPL-------TVMLVVEFFRGQDKRLHSPFP 170
            :||||.:::...||    ..|.:|..:||.:...:|.       ||:.::::   ..|.|.|  .
Zfish    39 QGFFCYETAYTKPYLGPEDTSAIPPALLYAVVTGVPTLMITVTETVLFLIQY---TSKDLDS--R 98

  Fly   171 KSTMCSGYHLCHLELPTWLVECYHRMGIFIFGLGVEQLSTNIAKYSIGRLRPHFYTLCQPVMKDG 235
            :.||.:| ..|:|.  ..:...:..:|:::|||....:..|..:...|.|.|||.|:|:|    .
Zfish    99 EKTMVTG-DCCYLN--PLVRRTFRFLGVYLFGLFTTDIFVNAGQVVTGNLAPHFLTVCKP----N 156

  Fly   236 TTCSDPINAARYI-EEFTCAAVDITSKQLKDMRLSFPSGHASFACYSMLYLVIYLHRRMQWKQLR 299
            .|......|.||| .:..|..   ....:...|.:|||..|:.:.|:.:|:.:|:...::.|..|
Zfish   157 FTALGCQQALRYISHQEACTG---NEDDILRARKTFPSKEAALSVYAAVYMAMYITFTVKAKGTR 218

  Fly   300 MLCHLLQFLLLMFAWYTALTRVSDYKHHWSDVLAGSGIGL---TYAVV 344
            :...::...|:..|:.|.:.||::|::|||||:||..||:   |:.||
Zfish   219 LAKPVMSLGLMCLAFLTGINRVAEYRNHWSDVIAGFIIGVAIATFLVV 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 47/158 (30%)
plppr5bXP_021325770.1 PAP2_wunen 116..265 CDD:239479 45/155 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577828
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.