DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and plppr5a

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001121841.1 Gene:plppr5a / 100006660 ZFINID:ZDB-GENE-070705-281 Length:309 Species:Danio rerio


Alignment Length:240 Identity:68/240 - (28%)
Similarity:110/240 - (45%) Gaps:29/240 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 RGFFCDDSSLRHPY----RDSTMPSWILYLMCGALPLTVMLVVE--FFRGQ------DKRLHSPF 169
            :||||.|::...||    ..|.:|..|||.:...:|..|:.|.|  .|..|      |.|     
Zfish    30 QGFFCHDNAYTKPYLGPEESSAIPPAILYAVVAGVPALVITVTESVLFLLQYVSEDLDNR----- 89

  Fly   170 PKSTMCSGYHLCHLELPTWLVECYHRMGIFIFGLGVEQLSTNIAKYSIGRLRPHFYTLCQPVMKD 234
             :..:..| ..|:|.  ..:...:..:|::.|||....:..|..:...|.|.|:|.|:|:|    
Zfish    90 -EKIIVMG-DCCYLN--PLVRRTFRFLGVYAFGLFATDIFVNAGQVVTGNLSPYFLTVCKP---- 146

  Fly   235 GTTCSDPINAARYI-EEFTCAAVDITSKQLKDMRLSFPSGHASFACYSMLYLVIYLHRRMQWKQL 298
            ..|........|:| ::..|..   ....:...|.||||..|:.:.|:.||:.:|:...::.|..
Zfish   147 NYTALGCQQVVRFINQQDACTG---NEDDILHARKSFPSKEAAISVYAALYVAMYITCSVKAKGT 208

  Fly   299 RMLCHLLQFLLLMFAWYTALTRVSDYKHHWSDVLAGSGIGLTYAV 343
            |:...:|...|:..|:.|.:.||.:|::||:||:||..||...||
Zfish   209 RLAKPVLSLGLMCLAFLTGINRVVEYRNHWADVIAGFIIGGAIAV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 45/154 (29%)
plppr5aNP_001121841.1 PAP2_wunen 107..256 CDD:239479 45/154 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577829
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.