DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and sgpp1b

DIOPT Version :9

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_001343219.1 Gene:sgpp1b / 100003745 ZFINID:ZDB-GENE-090319-2 Length:437 Species:Danio rerio


Alignment Length:81 Identity:20/81 - (24%)
Similarity:34/81 - (41%) Gaps:5/81 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 SFPSGHASFACYSMLYLVIYLHRRMQWKQLRMLCHLLQFLLLMFAWYTALTRVSDYKHHWSDVLA 333
            |.||.||.......|.|.:..:.|.::..|..|...:.:.:|:     .|:|:....|...|::|
Zfish   199 SMPSTHAMSGTAIPLSLFLLTYGRWEYPMLLGLSLAISWCVLV-----CLSRIYMGMHSILDIIA 258

  Fly   334 GSGIGLTYAVVVTSTM 349
            |....|...||.:..:
Zfish   259 GFLYSLLILVVFSPAL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 20/76 (26%)
sgpp1bXP_001343219.1 PgpB 109..280 CDD:223743 20/81 (25%)
PAP2_SPPase1 122..270 CDD:239482 19/75 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.