DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esn and Fhl2

DIOPT Version :9

Sequence 1:NP_001260760.1 Gene:esn / 53557 FlyBaseID:FBgn0263934 Length:1134 Species:Drosophila melanogaster
Sequence 2:NP_113865.1 Gene:Fhl2 / 63839 RGDID:61963 Length:279 Species:Rattus norvegicus


Alignment Length:278 Identity:70/278 - (25%)
Similarity:100/278 - (35%) Gaps:77/278 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   570 FSAQRKREALGRGAVRLLSDERP-CKGCEEPLSGGDIVVFAQRLGAQLC---------WHPGCFV 624
            |......|:| .|...:|.:|.| |..|.|.|...........:|.. |         ||.|||.
  Rat     5 FDCHHCNESL-YGKKYILKEENPHCVACFEELYANTCEECGTPIGCD-CKDLSYKDRHWHEGCFH 67

  Fly   625 CSVCKELLVDLIYFQRDGNLYCGRHHAETQKPRCSACDEII------------------------ 665
            ||.|...|||..:..::..|.|...::.....:|..|.:.|                        
  Rat    68 CSRCGSSLVDKPFAAKEEQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFTCQRC 132

  Fly   666 -------------------------FSDECTEAE-----------GRTWHMKHFACQECEHQLGG 694
                                     ::.:|.:.:           .:.||.:.|.|..|:.||.|
  Rat   133 QQPIGTKSFIPKENQNFCVPCYEKQYALQCVQCKKPITTGGVTYRDQPWHRECFVCTACKKQLSG 197

  Fly   695 QRYIMREGKPYCLACFDTMFAEYCDYCGEVIGVDQG--QMSHDGQHWHATDQCFSCCTCRCSLLG 757
            ||:..|:..||||.||..::|:.|..|...|....|  .:|.:.:.||  :.||:|..|..||:|
  Rat   198 QRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWH--NDCFNCKKCSLSLVG 260

  Fly   758 RPFLPRRGTIYCSIACSK 775
            |.||..|..|.|. .|.|
  Rat   261 RGFLTERDDILCP-DCGK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esnNP_001260760.1 PET_Prickle 492..588 CDD:193602 4/17 (24%)
LIM1_Prickle 593..651 CDD:188799 19/66 (29%)
LIM2_Prickle 656..711 CDD:188802 20/114 (18%)
LIM3_Prickle 716..774 CDD:188804 20/59 (34%)
Fhl2NP_113865.1 LIM <5..33 CDD:413332 9/28 (32%)
LIM 36..97 CDD:413332 15/61 (25%)
LIM2_FHL2 101..157 CDD:188810 3/55 (5%)
LIM 162..218 CDD:413332 18/55 (33%)
LIM4_FHL2 221..278 CDD:188817 22/60 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.