DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esn and LIMS2

DIOPT Version :9

Sequence 1:NP_001260760.1 Gene:esn / 53557 FlyBaseID:FBgn0263934 Length:1134 Species:Drosophila melanogaster
Sequence 2:NP_060450.2 Gene:LIMS2 / 55679 HGNCID:16084 Length:365 Species:Homo sapiens


Alignment Length:317 Identity:75/317 - (23%)
Similarity:100/317 - (31%) Gaps:114/317 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   537 YRVKQLLHQLPPQDNEVRYCHSLSDE------ERKELRIFSAQRKREALGRGAVRLLSDER--PC 593
            ||.:|.....||...      ::||.      :|.:.|...|:|...:.|.     |..|.  .|
Human    14 YRRRQHRQSPPPATG------NMSDALANAVCQRCQARFSPAERIVNSNGE-----LYHEHCFVC 67

  Fly   594 KGCEEPLSGGDIVVFA---------QRLGAQLC------------------WHPGCFVCSVCKEL 631
            ..|..|...|....|.         |.|.|..|                  ||||||.|.:|...
Human    68 AQCFRPFPEGLFYEFEGRKYCEHDFQMLFAPCCGSCGEFIIGRVIKAMNNNWHPGCFRCELCDVE 132

  Fly   632 LVDL---------------------------------------IYFQRD---------------- 641
            |.||                                       :.|:.|                
Human   133 LADLGFVKNAGRHLCRPCHNREKAKGLGKYICQRCHLVIDEQPLMFRSDAYHPDHFNCTHCGKEL 197

  Fly   642 --------GNLYCGRHHAETQKPRCSACDEIIFSDECTEAEGRTWHMKHFACQECEHQLGGQRYI 698
                    |.|||...|.:...|.|.||...| ......|.|:.||::||.|.:||....|.|:.
Human   198 TAEARELKGELYCLPCHDKMGVPICGACRRPI-EGRVVNALGKQWHVEHFVCAKCEKPFLGHRHY 261

  Fly   699 MREGKPYCLACFDTMFAEYCDYCGEVIGVDQGQMSHDGQHWHATDQCFSCCTCRCSL 755
            .::|..||...::.:|.:.|..|..||..|  .:|...:.|..:  ||||.||...|
Human   262 EKKGLAYCETHYNQLFGDVCYNCSHVIEGD--VVSALNKAWCVS--CFSCSTCNSKL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esnNP_001260760.1 PET_Prickle 492..588 CDD:193602 12/56 (21%)
LIM1_Prickle 593..651 CDD:188799 26/147 (18%)
LIM2_Prickle 656..711 CDD:188802 19/54 (35%)
LIM3_Prickle 716..774 CDD:188804 14/40 (35%)
LIMS2NP_060450.2 LIM1_PINCH 39..97 CDD:188717 14/62 (23%)
LIM2_PINCH 100..151 CDD:188718 12/50 (24%)
LIM3_PINCH 164..214 CDD:188719 6/49 (12%)
LIM4_PINCH 220..273 CDD:188720 19/53 (36%)
LIM5_PINCH 281..334 CDD:188721 14/38 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.