DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esn and fhl3b

DIOPT Version :9

Sequence 1:NP_001260760.1 Gene:esn / 53557 FlyBaseID:FBgn0263934 Length:1134 Species:Drosophila melanogaster
Sequence 2:NP_001093448.1 Gene:fhl3b / 555053 ZFINID:ZDB-GENE-030131-8356 Length:290 Species:Danio rerio


Alignment Length:260 Identity:71/260 - (27%)
Similarity:110/260 - (42%) Gaps:27/260 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   534 GEKY-RVKQLLHQLPPQD----NEVRYCHSLSDEERKEL---------RIFSAQRKREALGRGAV 584
            |:|| :|....|.:|..|    |....|..|.:...:||         :.|...|...:|.:.:.
Zfish    16 GQKYIQVDDKPHCVPCYDRLHANTCHECKELIEHNSRELYHEDRHYHEQCFRCSRCSRSLAKESF 80

  Fly   585 RLLSDERPCKG--CEEPLS-----GGDIVVFAQRLGAQLC-WHPGCFVCSVCKELLVDLIYFQRD 641
            ....|...|..  |.|..|     |..::..::||..:.| ||..||||..|::.:....:....
Zfish    81 TCQEDALVCNNCYC
NEFSSNCVACGKTVMPGSKRLEYEDCVWHEECFVCCGCEQPIGAQSFIPDK 145

  Fly   642 GNLYCGRHHAETQKPRCSACDEIIFSDECTEAEGRTWHMKHFACQECEHQLGGQRYIMREGKPYC 706
            ...||...:.....|||:.|.:.:.....|..: ..||.:.|.|..|:.||.||.:..:...|||
Zfish   146 DEYYCVPCYE
GRFAPRCAHCKQTLVQGGVTYRD-EPWHKECFLCTGCKVQLAGQPFTTQGEDPYC 209

  Fly   707 LACFDTMFAEYCDYCGE-VIGVDQGQ-MSHDGQHWHATDQCFSCCTCRCSLLGRPFLPRRGTIYC 769
            :.||..::|:.|..|.: :.|..:|: :|.:.:.||  ..||.|..|..||:|..|.|....|.|
Zfish   210 VKCF
SNLYAQKCAACEKPITGFGEGKYVSFEERQWH--KPCFKCSVCSLSLVGAGFFPHGSMILC 272

  Fly   770  769
            Zfish   273  272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esnNP_001260760.1 PET_Prickle 492..588 CDD:193602 15/67 (22%)
LIM1_Prickle 593..651 CDD:188799 17/65 (26%)
LIM2_Prickle 656..711 CDD:188802 18/54 (33%)
LIM3_Prickle 716..774 CDD:188804 18/56 (32%)
fhl3bNP_001093448.1 LIM <5..33 CDD:295319 6/16 (38%)
LIM1_FHL3 36..94 CDD:188807 10/57 (18%)
LIM2_FHL3 98..155 CDD:188811 14/56 (25%)
LIM3_FHL 162..213 CDD:188732 15/51 (29%)
LIM4_FHL3 221..276 CDD:188818 18/54 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.