Sequence 1: | NP_001260760.1 | Gene: | esn / 53557 | FlyBaseID: | FBgn0263934 | Length: | 1134 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001019386.1 | Gene: | FBLIM1 / 54751 | HGNCID: | 24686 | Length: | 374 | Species: | Homo sapiens |
Alignment Length: | 199 | Identity: | 57/199 - (28%) |
---|---|---|---|
Similarity: | 81/199 - (40%) | Gaps: | 34/199 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 658 CSACDEIIFSDE-CTEAEGRTWHMKHFACQECEHQLGGQRYIMREGKPYCLACF-DTMFAEYCDY 720
Fly 721 CGEVIGVDQGQMSHD----GQHWHATDQCFSCCTCRCSLLGRPF-LPRRGTIYC--------SIA 772
Fly 773 CSKGEPPTPSDTSSGPQ--LRPTHRASTSSQIA--KSPRRGGERERDPGRKAHHGHPKATGSAGD 833
Fly 834 LLER 837 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
esn | NP_001260760.1 | PET_Prickle | 492..588 | CDD:193602 | |
LIM1_Prickle | 593..651 | CDD:188799 | |||
LIM2_Prickle | 656..711 | CDD:188802 | 18/54 (33%) | ||
LIM3_Prickle | 716..774 | CDD:188804 | 19/70 (27%) | ||
FBLIM1 | NP_001019386.1 | Filamin-binding | 1..70 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 41..119 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 135..176 | ||||
LIM | 183..236 | CDD:259829 | 17/52 (33%) | ||
LIM2_FBLP-1 | 243..295 | CDD:188758 | 18/59 (31%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1704 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X39 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |