DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esn and FBLIM1

DIOPT Version :9

Sequence 1:NP_001260760.1 Gene:esn / 53557 FlyBaseID:FBgn0263934 Length:1134 Species:Drosophila melanogaster
Sequence 2:NP_001019386.1 Gene:FBLIM1 / 54751 HGNCID:24686 Length:374 Species:Homo sapiens


Alignment Length:199 Identity:57/199 - (28%)
Similarity:81/199 - (40%) Gaps:34/199 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   658 CSACDEIIFSDE-CTEAEGRTWHMKHFACQECEHQLGGQRYIMREGKPYCLACF-DTMFAEYCDY 720
            |:.|.:.:...| ..||..|.:|.:.|.|:.|..||.||.:..::|:|.|..|: ||:  |.|..
Human   183 CAFCHKTVSPRELAVEAMKRQYHAQCFTCRTCRRQLAGQSFYQKDGRPLCEPCYQDTL--ERCGK 245

  Fly   721 CGEVIGVDQGQMSHD----GQHWHATDQCFSCCTCRCSLLGRPF-LPRRGTIYC--------SIA 772
            ||||:      ..|.    ||.:|.:  ||:|.||...:....| |..:..:||        ...
Human   246 CGEVV------RDHIIRALGQAFHPS--CFTCVTCARCIGDESFALGSQNEVYCLDDFYRYEKGL 302

  Fly   773 CSKGEPPTPSDTSSGPQ--LRPTHRASTSSQIA--KSPRRGGERERDPGRKAHHGHPKATGSAGD 833
            |:.....|..|.|...:  |.|...|..|..:.  |...|.|     .|..||..:|...|..|.
Human   303 CTGWGAGTGRDPSRVKELSLSPGCWARVSCLLVYYKEYYRAG-----LGAVAHACNPSTLGGRGG 362

  Fly   834 LLER 837
            .:.|
Human   363 WITR 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esnNP_001260760.1 PET_Prickle 492..588 CDD:193602
LIM1_Prickle 593..651 CDD:188799
LIM2_Prickle 656..711 CDD:188802 18/54 (33%)
LIM3_Prickle 716..774 CDD:188804 19/70 (27%)
FBLIM1NP_001019386.1 Filamin-binding 1..70
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..119
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 135..176
LIM 183..236 CDD:259829 17/52 (33%)
LIM2_FBLP-1 243..295 CDD:188758 18/59 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.