DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esn and Lmcd1

DIOPT Version :9

Sequence 1:NP_001260760.1 Gene:esn / 53557 FlyBaseID:FBgn0263934 Length:1134 Species:Drosophila melanogaster
Sequence 2:NP_001008562.1 Gene:Lmcd1 / 494021 RGDID:1308963 Length:365 Species:Rattus norvegicus


Alignment Length:242 Identity:91/242 - (37%)
Similarity:118/242 - (48%) Gaps:35/242 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   503 YTWVPPGLRPDQVRLYFSQLPDDKVPYVNSPGEKYRVKQLLHQLPPQDNEVRYCHSLSDEERKEL 567
            |.|.|||:.......|...:|.:|.|...:.|..||.:||:||||..|.:...|..|.:.|.|.:
  Rat   118 YEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGALYRRRQLMHQLPIYDQDPSRCRGLVENELKAM 182

  Fly   568 RIFSAQRKREALGRGAVRL-----------LSDERP------------------------CKGCE 597
            ..|..|.|.||||.|.|.|           .:.|:|                        |:.|:
  Rat   183 EEFVKQYKSEALGVGEVALPG
QGGLPKEENKTQEKPEGTETTAPTTNGSLGDPSKEVEYVCELCK 247

  Fly   598 EPLSGGDIVVFAQRLGAQLCWHPGCFVCSVCKELLVDLIYFQRDGNLYCGRHHAETQKPRCSACD 662
            ........||:|.|.|....|||.||:|..|.|.|||||||.:||..:||||:.|:.:||||.||
  Rat   248 GVAPADSPVVYADRAGYSKQWHPTCFLCIKCSEPLVDLIYFWKDGAPWCGRHY
CESLRPRCSGCD 312

  Fly   663 EIIFSDECTEAEGRTWHMKHFACQECEHQLGGQRYIMREGKPYCLAC 709
            |||||::....|...||.|||.|:.||..|.|:.||:.:|:..|..|
  Rat   313 EIIFSEDYQRVEDLAWHRKHFICEGCEQLLSGRAYIITKGQLLCPTC 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esnNP_001260760.1 PET_Prickle 492..588 CDD:193602 33/95 (35%)
LIM1_Prickle 593..651 CDD:188799 28/57 (49%)
LIM2_Prickle 656..711 CDD:188802 27/54 (50%)
LIM3_Prickle 716..774 CDD:188804
Lmcd1NP_001008562.1 PET_testin 116..203 CDD:193604 33/84 (39%)
LIM1_Testin_like 243..300 CDD:188726 27/56 (48%)
LIM 306..359 CDD:413332 26/52 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422310at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.