DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esn and fhl3

DIOPT Version :9

Sequence 1:NP_001260760.1 Gene:esn / 53557 FlyBaseID:FBgn0263934 Length:1134 Species:Drosophila melanogaster
Sequence 2:NP_001008165.1 Gene:fhl3 / 493527 XenbaseID:XB-GENE-947662 Length:279 Species:Xenopus tropicalis


Alignment Length:235 Identity:67/235 - (28%)
Similarity:108/235 - (45%) Gaps:48/235 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   557 HSLSDEERKELRIFSAQRKREALGRGAVRLLSDE-------RPCKGCEEPLSGGDIVVFAQRL-- 612
            |||:||.      |:.|.:         .||.::       ..|..||:.:..|     :::|  
 Frog    73 HSLADEP------FTCQDE---------ELLCNDCYC
NEFSSKCISCEKTVMPG-----SRKLEY 117

  Fly   613 GAQLCWHPGCFVCSVCKELLVDLIYFQRDGNLYCGRHHAETQKPRCSACDE------IIFSDECT 671
            ..| .||..||:|:.|::.:....:...:.|.||...:.....|||:.|.:      :.:.||  
 Frog   118 NGQ-TWHEHCFICNSCQQPIGSRSFIPENQNHYCIPCYE
SKLAPRCTHCKKSLTKGGVTYRDE-- 179

  Fly   672 EAEGRTWHMKHFACQECEHQLGGQRYIMREGKPYCLACFDTMFAEYCDYCGEVIGVDQG--QMSH 734
                 .||.:.|.|..|:.||.||::..::.||||:.||..::|:.|..|.:.|....|  .:|.
 Frog   180 -----PWHKECFVCTGCKTQLAGQQFTSQDEKPYCIKCF
GNLYAKKCAGCTKPITGFGGAKYVSF 239

  Fly   735 DGQHWHATDQCFSCCTCRCSLLGRPFLPRRGTIYCSIACS 774
            :.:|||  ..||:|..|..||:|:.|:|....|.|. ||:
 Frog   240 EERHWH--HSCFNCSRCSTSLVGKGFIPDNEDILCR-ACN 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esnNP_001260760.1 PET_Prickle 492..588 CDD:193602 8/30 (27%)
LIM1_Prickle 593..651 CDD:188799 15/59 (25%)
LIM2_Prickle 656..711 CDD:188802 20/60 (33%)
LIM3_Prickle 716..774 CDD:188804 20/59 (34%)
fhl3NP_001008165.1 LIM <5..33 CDD:351770
LIM1_FHL3 36..94 CDD:188807 9/35 (26%)
LIM2_FHL3 98..155 CDD:188811 15/62 (24%)
LIM3_FHL 162..213 CDD:188732 17/57 (30%)
LIM4_FHL3 221..276 CDD:188818 20/57 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.