Sequence 1: | NP_001260760.1 | Gene: | esn / 53557 | FlyBaseID: | FBgn0263934 | Length: | 1134 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001006028.2 | Gene: | fhl2b / 450007 | ZFINID: | ZDB-GENE-041010-121 | Length: | 279 | Species: | Danio rerio |
Alignment Length: | 268 | Identity: | 68/268 - (25%) |
---|---|---|---|
Similarity: | 94/268 - (35%) | Gaps: | 80/268 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 582 GAVRLLSDERP-CKGCEEPLSGGDIVVFAQRLGAQLC-----------WHPGCFVCSVCKELLVD 634
Fly 635 LIYFQRDGNLYCGRHHAETQKPRCSACDEII---------------------------------- 665
Fly 666 ---------------FSDECTEAE-----------GRTWHMKHFACQECEHQLGGQRYIMREGKP 704
Fly 705 YCLACFDTMFAEYCDYCGEVIGVDQGQ--MSHDGQHWHATDQCFSCCTCRCSLLGRPFLPRRGTI 767
Fly 768 YCSIACSK 775 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
esn | NP_001260760.1 | PET_Prickle | 492..588 | CDD:193602 | 1/5 (20%) |
LIM1_Prickle | 593..651 | CDD:188799 | 18/68 (26%) | ||
LIM2_Prickle | 656..711 | CDD:188802 | 21/114 (18%) | ||
LIM3_Prickle | 716..774 | CDD:188804 | 20/59 (34%) | ||
fhl2b | NP_001006028.2 | LIM | <7..33 | CDD:295319 | 7/16 (44%) |
LIM | 36..97 | CDD:295319 | 14/63 (22%) | ||
LIM | 101..157 | CDD:295319 | 3/55 (5%) | ||
LIM3_Fhl2 | 162..218 | CDD:188815 | 18/55 (33%) | ||
LIM4_FHL2 | 221..278 | CDD:188817 | 22/60 (37%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X39 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |