DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esn and stck

DIOPT Version :9

Sequence 1:NP_001260760.1 Gene:esn / 53557 FlyBaseID:FBgn0263934 Length:1134 Species:Drosophila melanogaster
Sequence 2:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster


Alignment Length:275 Identity:67/275 - (24%)
Similarity:97/275 - (35%) Gaps:71/275 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   523 PDDKVPYVNSPGEKYRVK-----QLLHQLPPQDNEV------RYCHSLSDEERKELRIFSAQRKR 576
            |.:|:  |||.||.:..:     |...  |.||...      :||       .::..:..|    
  Fly    30 PTEKI--VNSNGELWHTQCFVCAQCFR--PFQDGIFYEFEGRKYC-------ERDFHVLFA---- 79

  Fly   577 EALGRGAVRLLSDERPCKGCEEPLSGGDIVVFAQRLGAQLCWHPGCFVCSVCKELLVDLIYFQRD 641
                           ||  |.:   .|:.|:..........|||.||.|.:|.:.|.|..:.:..
  Fly    80 ---------------PC--CNK---CGEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQ 124

  Fly   642 GNLYCGRHHAE-----TQKPRCSACDEIIFSDECTEAEGRTWHMKHFACQECEHQLGGQRYIMRE 701
            ....|...:|:     |.:..|..|..:| .:|.....|..:|..||:|..|..:|..   ..||
  Fly   125 NRALCHECNAKVKAEITGRYVCQKCHGLI-DEEPLRFRGEVYHGYHFSCTACGTELDS---TARE 185

  Fly   702 GKP------------YCLACFDTMFAEYCDYCGEVIGVDQGQMSHDGQHWHATDQCFSCCTCRCS 754
            .|.            |||.|.|.|....|..|...|  ::..::..|:|||.  :.|.|..|...
  Fly   186 VKSRPGLAANDMNELYCLRCHDKMGIPICGACRRPI--EERVVTALGKHWHV--EHFVCAKCEKP 246

  Fly   755 LLGRPFLPRRGTIYC 769
            .||.....:||..||
  Fly   247 FLGHRHYEKRGLAYC 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esnNP_001260760.1 PET_Prickle 492..588 CDD:193602 14/75 (19%)
LIM1_Prickle 593..651 CDD:188799 14/57 (25%)
LIM2_Prickle 656..711 CDD:188802 18/66 (27%)
LIM3_Prickle 716..774 CDD:188804 16/54 (30%)
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 13/59 (22%)
LIM2_PINCH 82..133 CDD:188718 13/53 (25%)
LIM3_PINCH 146..206 CDD:188719 17/63 (27%)
LIM4_PINCH 212..265 CDD:188720 16/54 (30%)
LIM5_PINCH 273..326 CDD:188721
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
32.810

Return to query results.
Submit another query.