Sequence 1: | NP_001260760.1 | Gene: | esn / 53557 | FlyBaseID: | FBgn0263934 | Length: | 1134 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_957364.2 | Gene: | lmcd1 / 394045 | ZFINID: | ZDB-GENE-040426-1067 | Length: | 342 | Species: | Danio rerio |
Alignment Length: | 223 | Identity: | 89/223 - (39%) |
---|---|---|---|
Similarity: | 113/223 - (50%) | Gaps: | 37/223 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 503 YTWVPPGLRPDQVRLYFSQLPDDKVPYVNSPGEKYRVKQLLHQLPPQDNEVRYCHSLSDEERKEL 567
Fly 568 RIFSAQRKREALGRGAVRL------------LSDERP------------------------CKGC 596
Fly 597 EEPLSGGDIVVFAQRLGAQLCWHPGCFVCSVCKELLVDLIYFQRDGNLYCGRHHAETQKPRCSAC 661
Fly 662 DEIIFSDE-CTEAEGRTWHMKHFACQEC 688 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
esn | NP_001260760.1 | PET_Prickle | 492..588 | CDD:193602 | 37/96 (39%) |
LIM1_Prickle | 593..651 | CDD:188799 | 30/57 (53%) | ||
LIM2_Prickle | 656..711 | CDD:188802 | 19/34 (56%) | ||
LIM3_Prickle | 716..774 | CDD:188804 | |||
lmcd1 | NP_957364.2 | PET_testin | 102..189 | CDD:193604 | 37/84 (44%) |
LIM1_Testin_like | 230..287 | CDD:188726 | 29/56 (52%) | ||
LIM | 293..>326 | CDD:295319 | 18/32 (56%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1704 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D422310at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X39 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.820 |