DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esn and lmcd1

DIOPT Version :9

Sequence 1:NP_001260760.1 Gene:esn / 53557 FlyBaseID:FBgn0263934 Length:1134 Species:Drosophila melanogaster
Sequence 2:NP_957364.2 Gene:lmcd1 / 394045 ZFINID:ZDB-GENE-040426-1067 Length:342 Species:Danio rerio


Alignment Length:223 Identity:89/223 - (39%)
Similarity:113/223 - (50%) Gaps:37/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   503 YTWVPPGLRPDQVRLYFSQLPDDKVPYVNSPGEKYRVKQLLHQLPPQDNEVRYCHSLSDEERKEL 567
            |.|.|.||......||.|.||:::.|...:.|..||.|||..|||..|::..||||||:.|.|.:
Zfish   104 YDWAPTGLTQKLAMLYMSLLPEERRPVAGTEGSLYRHKQLTRQLPAYDHDPAYCHSLSEAELKVM 168

  Fly   568 RIFSAQRKREALGRGAVRL------------LSDERP------------------------CKGC 596
            ..|....|.|:||.|.|.|            :|.|:|                        |.||
Zfish   169 AQFVKSYKEESLGVGEVALPG
EKSTTKRNEKISQEQPDPPLTEQTPDGAIESPVSNETEYYCSGC 233

  Fly   597 EEPLSGGDIVVFAQRLGAQLCWHPGCFVCSVCKELLVDLIYFQRDGNLYCGRHHAETQKPRCSAC 661
            .:..:..:.||:|.|.|.:..|||.||||..|.|.|||||||.::|.|.||||:.::.:|||..|
Zfish   234 GQLAAMDEPVVYADRAGYERLWHPACFVCGECGEALVDLIYFWKEGALLCGRHY
CQSIRPRCLGC 298

  Fly   662 DEIIFSDE-CTEAEGRTWHMKHFACQEC 688
            ||:||||. ..||.|..||.:||.|..|
Zfish   299 DELIFSDMLLQEASGHVWHKEHFCCWLC 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esnNP_001260760.1 PET_Prickle 492..588 CDD:193602 37/96 (39%)
LIM1_Prickle 593..651 CDD:188799 30/57 (53%)
LIM2_Prickle 656..711 CDD:188802 19/34 (56%)
LIM3_Prickle 716..774 CDD:188804
lmcd1NP_957364.2 PET_testin 102..189 CDD:193604 37/84 (44%)
LIM1_Testin_like 230..287 CDD:188726 29/56 (52%)
LIM 293..>326 CDD:295319 18/32 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422310at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.