DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esn and Fhl4

DIOPT Version :9

Sequence 1:NP_001260760.1 Gene:esn / 53557 FlyBaseID:FBgn0263934 Length:1134 Species:Drosophila melanogaster
Sequence 2:NP_001013190.2 Gene:Fhl4 / 314678 RGDID:1308978 Length:280 Species:Rattus norvegicus


Alignment Length:197 Identity:57/197 - (28%)
Similarity:91/197 - (46%) Gaps:33/197 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   593 CKGCEEPLSGGDIVVFAQRLGAQLCWHPGCFVCSVCKELLVDLIYFQRDGNLYCGRHHAETQKPR 657
            ||||.:.:..|:..|  :..|.  .||..|||||.|||::....:|.:|...|            
  Rat   100 CKGCLKDIKQGEQSV--EYKGT--IWHKDCFVCSNCKEVIGTKTFFPKDEGFY------------ 148

  Fly   658 CSACDEIIFSDECTEA-----------EGRTWHMKHFACQECEHQLGGQRYIMREGKPYCLACFD 711
            |.||.:|:|:..|.:.           :.:.||.:.|.|..|..:|..||:.:.:.|.:|:.|:.
  Rat   149 CVACYDILFTKYCVKCNKPITSGGVSYQDQPWHSECFVCVNCSKELSEQRFTVMDDKIFCVDCYK 213

  Fly   712 TMFAEYCDYC-GEVIGVDQGQ--MSHDGQHWHATDQCFSCCTCRCSLLGRPFLPRRGTIYCSIAC 773
            ...|:.|..| ..:.|..:|.  ::|:...||  |.||:|..|..:|..:.|:..:..|||. .|
  Rat   214 NFIAKKCAGCKNPITGFGKGSNVVTHETNSWH--DYCFNCKACSVNLANKHFVFHQEQIYCP-DC 275

  Fly   774 SK 775
            :|
  Rat   276 AK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esnNP_001260760.1 PET_Prickle 492..588 CDD:193602
LIM1_Prickle 593..651 CDD:188799 20/57 (35%)
LIM2_Prickle 656..711 CDD:188802 17/65 (26%)
LIM3_Prickle 716..774 CDD:188804 17/60 (28%)
Fhl4NP_001013190.2 LIM 39..91 CDD:413332
LIM 100..157 CDD:413332 24/72 (33%)
LIM 161..213 CDD:413332 12/51 (24%)
LIM 216..279 CDD:413332 20/65 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.