DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esn and Fhl3

DIOPT Version :9

Sequence 1:NP_001260760.1 Gene:esn / 53557 FlyBaseID:FBgn0263934 Length:1134 Species:Drosophila melanogaster
Sequence 2:NP_001101449.1 Gene:Fhl3 / 313582 RGDID:1307180 Length:288 Species:Rattus norvegicus


Alignment Length:247 Identity:73/247 - (29%)
Similarity:107/247 - (43%) Gaps:47/247 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   554 RYC---HSLSDEERKELRIFSAQRKREALGRGAVRLLSDE-------RPCKGCEEPLSGGDIVVF 608
            |.|   .||:||.      |:.|..         .||.:|       ..|..|.|.:..|     
  Rat    67 RCCRCQRSLADEP------FTCQDS---------ELLCNECYC
TAFSSQCSACGETVMPG----- 111

  Fly   609 AQRL--GAQLCWHPGCFVCSVCKELLVDLIYFQRDGNLYCGRHHAETQKPRCSACDEIIFSDECT 671
            :::|  |.| .||..||:||.|::.|....:....|..||...:.....|||:.|.:.:.....|
  Rat   112 SRKLEYGGQ-TWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYE
NKFAPRCARCSKTLTQGGVT 175

  Fly   672 EAEGRTWHMKHFACQECEHQLGGQRYIMREGKPYCLACFDTMFAEYCDYC---------GEVIGV 727
            ..: :.||.:...|..|:..|.||::..|:..|||:|||..:||..|..|         .|..|:
  Rat   176 YRD-QPWHRECLVCTGCQTPLAGQQFTSRDDDPYCVACF
GELFAPKCSSCKRPITGGSGSEGAGL 239

  Fly   728 DQGQ-MSHDGQHWHATDQCFSCCTCRCSLLGRPFLPRRGTIYCSIACSKGEP 778
            ..|: :|.:.:|||  ..||||..|..||:|:.|:|....:.|. .||:..|
  Rat   240 GGGKYVSFEDRHWH--HSCFSCARCSTSLVGQGFVPDGDQVLCQ-GCSQAGP 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esnNP_001260760.1 PET_Prickle 492..588 CDD:193602 9/36 (25%)
LIM1_Prickle 593..651 CDD:188799 18/59 (31%)
LIM2_Prickle 656..711 CDD:188802 18/54 (33%)
LIM3_Prickle 716..774 CDD:188804 20/67 (30%)
Fhl3NP_001101449.1 LIM <5..33 CDD:413332
LIM1_FHL3 36..94 CDD:188807 11/41 (27%)
LIM2_FHL3 98..155 CDD:188811 18/62 (29%)
LIM3_FHL 162..213 CDD:188732 15/51 (29%)
LIM 221..284 CDD:413332 20/65 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.