Sequence 1: | NP_001260760.1 | Gene: | esn / 53557 | FlyBaseID: | FBgn0263934 | Length: | 1134 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_055398.1 | Gene: | LMCD1 / 29995 | HGNCID: | 6633 | Length: | 365 | Species: | Homo sapiens |
Alignment Length: | 245 | Identity: | 93/245 - (37%) |
---|---|---|---|
Similarity: | 119/245 - (48%) | Gaps: | 41/245 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 503 YTWVPPGLRPDQVRLYFSQLPDDKVPYVNSPGEKYRVKQLLHQLPPQDNEVRYCHSLSDEERKEL 567
Fly 568 RIFSAQRKREALGRGAVRL-----------LSDERP---------------------------CK 594
Fly 595 GCEEPLSGGDIVVFAQRLGAQLCWHPGCFVCSVCKELLVDLIYFQRDGNLYCGRHHAETQKPRCS 659
Fly 660 ACDEIIFSDECTEAEGRTWHMKHFACQECEHQLGGQRYIMREGKPYCLAC 709 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
esn | NP_001260760.1 | PET_Prickle | 492..588 | CDD:193602 | 33/95 (35%) |
LIM1_Prickle | 593..651 | CDD:188799 | 31/57 (54%) | ||
LIM2_Prickle | 656..711 | CDD:188802 | 26/54 (48%) | ||
LIM3_Prickle | 716..774 | CDD:188804 | |||
LMCD1 | NP_055398.1 | PET_testin | 116..203 | CDD:193604 | 33/84 (39%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 200..235 | 3/34 (9%) | |||
LIM1_Testin_like | 243..300 | CDD:188726 | 30/59 (51%) | ||
LIM | 306..359 | CDD:295319 | 25/52 (48%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1704 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D422310at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X39 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.820 |