DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esn and FHL3

DIOPT Version :9

Sequence 1:NP_001260760.1 Gene:esn / 53557 FlyBaseID:FBgn0263934 Length:1134 Species:Drosophila melanogaster
Sequence 2:NP_004459.2 Gene:FHL3 / 2275 HGNCID:3704 Length:280 Species:Homo sapiens


Alignment Length:238 Identity:69/238 - (28%)
Similarity:106/238 - (44%) Gaps:48/238 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   549 QDNEVR----YCHSLSDEERKELRIFSAQRKREALGRGAVRLLSDERPCKGCEEPLSGGDIVVFA 609
            ||:|:.    ||.:           ||:|                   |..|.|.:..|     :
Human    83 QDSELLCNDCYC
SA-----------FSSQ-------------------CSACGETVMPG-----S 112

  Fly   610 QRL--GAQLCWHPGCFVCSVCKELLVDLIYFQRDGNLYCGRHHAETQKPRCSACDEIIFSDECTE 672
            ::|  |.| .||..||:||.|::.|....:....|..||...:.....|||:.|.:.:.....|.
Human   113 RKLEYGGQ-TWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYE
NKFAPRCARCSKTLTQGGVTY 176

  Fly   673 AEGRTWHMKHFACQECEHQLGGQRYIMREGKPYCLACFDTMFAEYCDYCGE-VIGVDQGQ-MSHD 735
            .: :.||.:...|..|:..|.||::..|:..|||:|||..:||..|..|.. ::|:..|: :|.:
Human   177 RD-QPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACF
GELFAPKCSSCKRPIVGLGGGKYVSFE 240

  Fly   736 GQHWHATDQCFSCCTCRCSLLGRPFLPRRGTIYCSIACSKGEP 778
            .:|||  ..||||..|..||:|:.|:|....:.|. .||:..|
Human   241 DRHWH--HNCFSCARCSTSLVGQGFVPDGDQVLCQ-GCSQAGP 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esnNP_001260760.1 PET_Prickle 492..588 CDD:193602 8/42 (19%)
LIM1_Prickle 593..651 CDD:188799 18/59 (31%)
LIM2_Prickle 656..711 CDD:188802 18/54 (33%)
LIM3_Prickle 716..774 CDD:188804 19/59 (32%)
FHL3NP_004459.2 LIM <5..33 CDD:295319
LIM1_FHL3 36..94 CDD:188807 3/10 (30%)
LIM2_FHL3 98..155 CDD:188811 20/81 (25%)
LIM3_FHL 162..213 CDD:188732 15/51 (29%)
LIM4_FHL3 221..276 CDD:188818 19/57 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.