DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esn and FHL2

DIOPT Version :9

Sequence 1:NP_001260760.1 Gene:esn / 53557 FlyBaseID:FBgn0263934 Length:1134 Species:Drosophila melanogaster
Sequence 2:NP_001034581.1 Gene:FHL2 / 2274 HGNCID:3703 Length:279 Species:Homo sapiens


Alignment Length:185 Identity:56/185 - (30%)
Similarity:88/185 - (47%) Gaps:10/185 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   593 CKGCEEPLSGGDIVVFAQRLGAQLCWHPGCFVCSVCKELLVDLIYFQRDGNLYCGRHHAETQKPR 657
            |:.|::.:..|...:  :..|:.  ||..||:|..|::.:....:..:|...:|...:.:....:
Human   101 CQECKKTIMPGTRKM--EYKGSS--WHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQ 161

  Fly   658 CSACDEIIFSDECTEAEGRTWHMKHFACQECEHQLGGQRYIMREGKPYCLACFDTMFAEYCDYCG 722
            |..|.:.|.:...|..| :.||.:.|.|..|..||.|||:..|:...|||.||..::|:.|..|.
Human   162 CVQCKKPITTGGVTYRE-QPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCT 225

  Fly   723 EVIGVDQG--QMSHDGQHWHATDQCFSCCTCRCSLLGRPFLPRRGTIYCSIACSK 775
            ..|....|  .:|.:.:.||  :.||:|..|..||:||.||..|..|.|. .|.|
Human   226 NPISGLGGTKYISFEERQWH--NDCFNCKKCSLSLVGRGFLTERDDILCP-DCGK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esnNP_001260760.1 PET_Prickle 492..588 CDD:193602
LIM1_Prickle 593..651 CDD:188799 12/57 (21%)
LIM2_Prickle 656..711 CDD:188802 20/54 (37%)
LIM3_Prickle 716..774 CDD:188804 20/59 (34%)
FHL2NP_001034581.1 LIM <5..33 CDD:413332
LIM1_FHL2 36..97 CDD:188806
LIM2_FHL2 101..157 CDD:188810 12/59 (20%)
LIM3_Fhl2 162..218 CDD:188815 21/56 (38%)
LIM4_FHL2 221..278 CDD:188817 22/60 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.