Sequence 1: | NP_001260760.1 | Gene: | esn / 53557 | FlyBaseID: | FBgn0263934 | Length: | 1134 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001255672.1 | Gene: | pin-2 / 178234 | WormBaseID: | WBGene00004030 | Length: | 330 | Species: | Caenorhabditis elegans |
Alignment Length: | 243 | Identity: | 59/243 - (24%) |
---|---|---|---|
Similarity: | 83/243 - (34%) | Gaps: | 73/243 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 591 RPCKGCEEPLSGGDIVVFAQRLGAQLCWHPGCFVCSVCKELLVDLIYFQRDGNLYCGRHHAETQK 655
Fly 656 PRCSACDEIIFSDECTEAEGRTWHMKHFACQECEHQLGGQ---RY-------IMREGKP------ 704
Fly 705 ----------------------------------------------YCLACFDTMFAEYCDYCGE 723
Fly 724 VIG--VDQGQMSHDGQHWHATDQCFSCCTCRCSLLGRPFLPRRGTIYC 769 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
esn | NP_001260760.1 | PET_Prickle | 492..588 | CDD:193602 | |
LIM1_Prickle | 593..651 | CDD:188799 | 19/57 (33%) | ||
LIM2_Prickle | 656..711 | CDD:188802 | 17/116 (15%) | ||
LIM3_Prickle | 716..774 | CDD:188804 | 20/56 (36%) | ||
pin-2 | NP_001255672.1 | LIM1_PINCH | 21..79 | CDD:188717 | 19/61 (31%) |
LIM | 82..133 | CDD:295319 | 12/51 (24%) | ||
LIM | 144..195 | CDD:295319 | 1/50 (2%) | ||
LIM4_PINCH | 200..256 | CDD:188720 | 20/56 (36%) | ||
LIM | 264..315 | CDD:295319 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |