DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esn and pin-2

DIOPT Version :9

Sequence 1:NP_001260760.1 Gene:esn / 53557 FlyBaseID:FBgn0263934 Length:1134 Species:Drosophila melanogaster
Sequence 2:NP_001255672.1 Gene:pin-2 / 178234 WormBaseID:WBGene00004030 Length:330 Species:Caenorhabditis elegans


Alignment Length:243 Identity:59/243 - (24%)
Similarity:83/243 - (34%) Gaps:73/243 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   591 RPCKGCEEPLSGGDIVVFAQRLGAQLCWHPGCFVCSVCKELLVDLIYFQRDGNLYCGRHHAETQK 655
            |.|:.|.|.....:....   |||. .||..||:|:.|.:.||...|||.:..:||.........
 Worm    19 RACERCREQFELNEPYFL---LGAS-SWHMRCFLCAQCMDPLVGTTYFQFENRIYCEHDFKTLYA 79

  Fly   656 PRCSACDEIIFSDECTEAEGRTWHMKHFACQECEHQLGGQ---RY-------IMREGKP------ 704
            |.|:.|:|.:.. :...:...::|:..|.|.||...|..|   ||       :..:.||      
 Worm    80 PVCAKCNEFVIG-QVVHSSNNSYHLACFTCDECNVHLNSQIAYRYQGTILCFLCNQKKPKMRIYN 143

  Fly   705 ----------------------------------------------YCLACFDTMFAEYCDYCGE 723
                                                          :|..||| ...|.|..|.:
 Worm   144 CNKCKQHVDNSDLLTYQENPYHAYHFKCTTCKKVLESDARTIKDDLFCPRCFD-FKCEVCFDCKK 207

  Fly   724 VIG--VDQGQMSHDGQHWHATDQCFSCCTCRCSLLGRPFLPRRGTIYC 769
            ||.  |:|...:.: :||| ||. |.|.||.....|.....:.|..||
 Worm   208 VIDPQVEQSIFTMN-KHWH-TDH-FRCATCARPFFGHEHYEKNGKAYC 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esnNP_001260760.1 PET_Prickle 492..588 CDD:193602
LIM1_Prickle 593..651 CDD:188799 19/57 (33%)
LIM2_Prickle 656..711 CDD:188802 17/116 (15%)
LIM3_Prickle 716..774 CDD:188804 20/56 (36%)
pin-2NP_001255672.1 LIM1_PINCH 21..79 CDD:188717 19/61 (31%)
LIM 82..133 CDD:295319 12/51 (24%)
LIM 144..195 CDD:295319 1/50 (2%)
LIM4_PINCH 200..256 CDD:188720 20/56 (36%)
LIM 264..315 CDD:295319
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.