Sequence 1: | NP_001260760.1 | Gene: | esn / 53557 | FlyBaseID: | FBgn0263934 | Length: | 1134 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034344.2 | Gene: | Fhl4 / 14202 | MGIID: | 1338765 | Length: | 279 | Species: | Mus musculus |
Alignment Length: | 219 | Identity: | 59/219 - (26%) |
---|---|---|---|
Similarity: | 88/219 - (40%) | Gaps: | 41/219 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 590 ERPCKGCEEPLSGGDIVVFAQRLGAQLC--------------------------------WHPGC 622
Fly 623 FVCSVCKELLVDLIYFQRDGNLYCGRHHAETQKPRCSAC-DEIIFSDECTEAEGRTWHMKHFACQ 686
Fly 687 ECEHQLGGQRYIMREGKPYCLACFDTMFAEYCDYCGEVIGVDQGQMSHDGQHWHATDQCFSCCTC 751
Fly 752 RCSLLGRPFLPRRGTIYCSIACSK 775 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
esn | NP_001260760.1 | PET_Prickle | 492..588 | CDD:193602 | |
LIM1_Prickle | 593..651 | CDD:188799 | 22/89 (25%) | ||
LIM2_Prickle | 656..711 | CDD:188802 | 16/55 (29%) | ||
LIM3_Prickle | 716..774 | CDD:188804 | 16/57 (28%) | ||
Fhl4 | NP_034344.2 | LIM | <4..32 | CDD:295319 | 10/30 (33%) |
LIM | 39..92 | CDD:295319 | 12/52 (23%) | ||
LIM2_FHL1 | 100..157 | CDD:188808 | 16/56 (29%) | ||
LIM3_FHL1 | 161..213 | CDD:188813 | 17/56 (30%) | ||
LIM4_FHL1 | 216..279 | CDD:188734 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1704 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X39 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |