DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esn and Fhl4

DIOPT Version :9

Sequence 1:NP_001260760.1 Gene:esn / 53557 FlyBaseID:FBgn0263934 Length:1134 Species:Drosophila melanogaster
Sequence 2:NP_034344.2 Gene:Fhl4 / 14202 MGIID:1338765 Length:279 Species:Mus musculus


Alignment Length:219 Identity:59/219 - (26%)
Similarity:88/219 - (40%) Gaps:41/219 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   590 ERPCKGCEEPLSGGDIVVFAQRLGAQLC--------------------------------WHPGC 622
            |..|..|||.|.|..   :.|:.||..|                                ||..|
Mouse     3 EFKCHHCEESLQGKK---YVQKDGANYCVTCFDSHCANICQECHKPIGADSKEVCYKEQFWHNTC 64

  Fly   623 FVCSVCKELLVDLIYFQRDGNLYCGRHHAETQKPRCSAC-DEIIFSDECTEAEGRTWHMKHFACQ 686
            |.||.|.:||....:...|.|:.|.:.......|:|..| .:|...|...|.:|..||...|.|.
Mouse    65 FKCSKCSQLLATETFVAWDKNILCNKCATRVTFPKCKGCLKDIEEGDHNVEYKGSIWHKNCFVCT 129

  Fly   687 ECEHQLGGQRYIMREGKPYCLACFDTMFAEYCDYCGEVIGVDQGQMSHDGQHWHATDQCFSCCTC 751
            .|:..:|.:.:..::...||:.|:|.:|.::|..|.:.|  ..|.:|:..|.||:  :||.|.:|
Mouse   130 NCKDIIGTKNFFPKDEGFYCVTCYDALFTKHCMKCKKPI--TSGGVSYQDQPWHS--ECFVCVSC 190

  Fly   752 RCSLLGRPFLPRRGTIYCSIACSK 775
            ...|.|:.|.......:| :.|.|
Mouse   191 SKELSGQRFTAMDDQYFC-VDCYK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esnNP_001260760.1 PET_Prickle 492..588 CDD:193602
LIM1_Prickle 593..651 CDD:188799 22/89 (25%)
LIM2_Prickle 656..711 CDD:188802 16/55 (29%)
LIM3_Prickle 716..774 CDD:188804 16/57 (28%)
Fhl4NP_034344.2 LIM <4..32 CDD:295319 10/30 (33%)
LIM 39..92 CDD:295319 12/52 (23%)
LIM2_FHL1 100..157 CDD:188808 16/56 (29%)
LIM3_FHL1 161..213 CDD:188813 17/56 (30%)
LIM4_FHL1 216..279 CDD:188734
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.