DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esn and Fhl1

DIOPT Version :9

Sequence 1:NP_001260760.1 Gene:esn / 53557 FlyBaseID:FBgn0263934 Length:1134 Species:Drosophila melanogaster
Sequence 2:XP_006527864.1 Gene:Fhl1 / 14199 MGIID:1298387 Length:339 Species:Mus musculus


Alignment Length:272 Identity:72/272 - (26%)
Similarity:104/272 - (38%) Gaps:58/272 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   584 VRLLSDERPCKGCEEPLSGGDIVVFAQRLGAQLC------------------------------- 617
            |..:|::..|..|.:||.|..   :.|:.|...|                               
Mouse    14 VGTMSEKFDCHYCRDPLQGKK---YVQKDGRHCCLKCFDKFCANTCVDCRKPISADAKEVHYKNR 75

  Fly   618 -WHPGCFVCSVCKELLVDLIYFQRDGNLYCGRHHAETQKPRCSAC-DEIIFSDECTEAEGRTWHM 680
             ||..||.|:.|...|....:..:||.:.|.:.......|||..| ..|:..|:..|.:|..||.
Mouse    76 YWHDNCFRCAKCLHPLASETFVSKDGKILCNKCATREDSPRCKGCFKAIVAGDQNVEYKGTVWHK 140

  Fly   681 KHFACQECEHQLGGQRYIMREGKPYCLACFDTMFAEYCDYCGEVIGVDQGQMSHDGQHWHATDQC 745
            ..|.|..|:..:|...:..:....||:.|.:|.||::|..|.:.|  ..|.:::..|.|||  :|
Mouse   141 DCFTCSNCKQVIGTGSFFPKGEDFYCVTCHETKFAKHCVKCNKAI--TSGGITYQDQPWHA--EC 201

  Fly   746 FSCCTCRCSLLGRPFLPRRGTIYCSIACSKG----------EPPTPSDTSSGPQLRPTHRASTSS 800
            |.|.||...|.|:.|.......|| :.|.|.          .|.|...|.|    |.:|..   |
Mouse   202 FVCVTCSKKLAGQRFTAVEDQYYC-VDCYKNFVAKKCAGCKNPITGKRTVS----RVSHPV---S 258

  Fly   801 QIAKSPRRGGER 812
            :..|||...|:|
Mouse   259 KARKSPVCHGKR 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esnNP_001260760.1 PET_Prickle 492..588 CDD:193602 1/3 (33%)
LIM1_Prickle 593..651 CDD:188799 18/89 (20%)
LIM2_Prickle 656..711 CDD:188802 17/55 (31%)
LIM3_Prickle 716..774 CDD:188804 18/57 (32%)
Fhl1XP_006527864.1 LIM <21..49 CDD:351770 8/30 (27%)
LIM1_FHL1 56..109 CDD:188730 10/52 (19%)
LIM2_FHL1 117..174 CDD:188808 16/56 (29%)
LIM3_FHL1 178..230 CDD:188813 19/56 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.