Sequence 1: | NP_001260760.1 | Gene: | esn / 53557 | FlyBaseID: | FBgn0263934 | Length: | 1134 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006527864.1 | Gene: | Fhl1 / 14199 | MGIID: | 1298387 | Length: | 339 | Species: | Mus musculus |
Alignment Length: | 272 | Identity: | 72/272 - (26%) |
---|---|---|---|
Similarity: | 104/272 - (38%) | Gaps: | 58/272 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 584 VRLLSDERPCKGCEEPLSGGDIVVFAQRLGAQLC------------------------------- 617
Fly 618 -WHPGCFVCSVCKELLVDLIYFQRDGNLYCGRHHAETQKPRCSAC-DEIIFSDECTEAEGRTWHM 680
Fly 681 KHFACQECEHQLGGQRYIMREGKPYCLACFDTMFAEYCDYCGEVIGVDQGQMSHDGQHWHATDQC 745
Fly 746 FSCCTCRCSLLGRPFLPRRGTIYCSIACSKG----------EPPTPSDTSSGPQLRPTHRASTSS 800
Fly 801 QIAKSPRRGGER 812 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
esn | NP_001260760.1 | PET_Prickle | 492..588 | CDD:193602 | 1/3 (33%) |
LIM1_Prickle | 593..651 | CDD:188799 | 18/89 (20%) | ||
LIM2_Prickle | 656..711 | CDD:188802 | 17/55 (31%) | ||
LIM3_Prickle | 716..774 | CDD:188804 | 18/57 (32%) | ||
Fhl1 | XP_006527864.1 | LIM | <21..49 | CDD:351770 | 8/30 (27%) |
LIM1_FHL1 | 56..109 | CDD:188730 | 10/52 (19%) | ||
LIM2_FHL1 | 117..174 | CDD:188808 | 16/56 (29%) | ||
LIM3_FHL1 | 178..230 | CDD:188813 | 19/56 (34%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1704 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X39 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |