DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esn and LOC110438489

DIOPT Version :9

Sequence 1:NP_001260760.1 Gene:esn / 53557 FlyBaseID:FBgn0263934 Length:1134 Species:Drosophila melanogaster
Sequence 2:XP_021326686.1 Gene:LOC110438489 / 110438489 -ID:- Length:194 Species:Danio rerio


Alignment Length:154 Identity:104/154 - (67%)
Similarity:122/154 - (79%) Gaps:3/154 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   514 QVRLYFSQLPDDKVPYVNSPGEKYRVKQLLHQLPPQDNEVRYCHSLSDEERKELRIFSAQRKREA 578
            ||..|:|.||:||||||||||||||:|||||||||.|||||||:||.|||::||::||.|||||.
Zfish    26 QVHQYYSSLPEDKVPYVNSPGEKYRIKQLLHQLPPHDNEVRYCNSLDDEEKRELKLFSNQRKREN 90

  Fly   579 LGRGAVR---LLSDERPCKGCEEPLSGGDIVVFAQRLGAQLCWHPGCFVCSVCKELLVDLIYFQR 640
            ||||.||   :......|:.|...::||||.|||.|.|..:||||.|||||:|.|||||||||.:
Zfish    91 LGRGNVRPFPVTMTGAICEQCGGQINGGDIAVFASRAGHGVCWHPQCFVCSMCDELLVDLIYFYQ 155

  Fly   641 DGNLYCGRHHAETQKPRCSACDEI 664
            ||.::|||||||..|||||||||:
Zfish   156 DGKIFCGRHHAERLKPRCSACDEV 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esnNP_001260760.1 PET_Prickle 492..588 CDD:193602 56/76 (74%)
LIM1_Prickle 593..651 CDD:188799 36/57 (63%)
LIM2_Prickle 656..711 CDD:188802 8/9 (89%)
LIM3_Prickle 716..774 CDD:188804
LOC110438489XP_021326686.1 PET_Prickle <27..100 CDD:193602 55/72 (76%)
LIM1_Prickle 108..166 CDD:188799 36/57 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422310at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.