DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbo and AT1G67480

DIOPT Version :9

Sequence 1:NP_524989.2 Gene:dbo / 53556 FlyBaseID:FBgn0040230 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_001077785.1 Gene:AT1G67480 / 843069 AraportID:AT1G67480 Length:376 Species:Arabidopsis thaliana


Alignment Length:189 Identity:60/189 - (31%)
Similarity:88/189 - (46%) Gaps:27/189 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 VLDGFLYAV----GGQDGVQCLNHVERYDPKENKWSKVAPMT-TRRLGVAVAVLGGFLYAIGGSD 473
            :|:.:||.:    ||:|     |..|..|....|.|.:.||. ..:.|..|.|:.|.|..|.|. 
plant    88 MLEEWLYVLTMNAGGKD-----NRWEVMDCLGQKLSSLPPMPGPAKTGFKVVVVDGKLLVIAGC- 146

  Fly   474 GQCPLN-------TVERYDPRHNKWVAVSPMSTRRKHLGCAVFNNYIYAVGGRD-DCMELSSAER 530
              |.:|       .|.:||...|.|..::.:...|....||..|.::|.|||.. |...|||||.
plant   147 --CMINGSLVASADVYQYDTCLNSWSRLADLEVARYDFACAEVNGHVYVVGGHGVDGESLSSAEV 209

  Fly   531 YNPLTNTWSPIVAMTSRRSGVGLAVVNGQLYAVGGFD----GSAYLKTIEVYDPETNQW 585
            |:|.|.||:.|.::...|.|...:..||:||.:||..    |::  |.::||:.:...|
plant   210 YDPETCTWTFIESLRRPRWGCFASAFNGKLYVMGGRSNFTIGNS--KLLDVYNTQCGSW 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dboNP_524989.2 BTB_POZ_KLHL20_KLEIP 49..176 CDD:349558
PHA03098 69..587 CDD:222983 60/189 (32%)
KELCH repeat 359..403 CDD:276965
KELCH repeat 407..451 CDD:276965 12/40 (30%)
KELCH repeat 454..497 CDD:276965 14/49 (29%)
KELCH repeat 501..545 CDD:276965 20/44 (45%)
KELCH repeat 548..593 CDD:276965 13/42 (31%)
AT1G67480NP_001077785.1 F-box 38..79 CDD:279040
Kelch_1 129..175 CDD:279660 14/48 (29%)
KELCH repeat 130..175 CDD:276965 14/47 (30%)
Kelch_1 178..224 CDD:279660 20/45 (44%)
KELCH repeat 179..224 CDD:276965 20/44 (45%)
KELCH repeat 227..267 CDD:276965 13/42 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I2576
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D731760at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.