DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbo and AT5G51250

DIOPT Version :9

Sequence 1:NP_524989.2 Gene:dbo / 53556 FlyBaseID:FBgn0040230 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_199938.1 Gene:AT5G51250 / 835199 AraportID:AT5G51250 Length:368 Species:Arabidopsis thaliana


Alignment Length:264 Identity:51/264 - (19%)
Similarity:85/264 - (32%) Gaps:84/264 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 GEVLFAVGGWC-SGDAIASVERFDPQTNDWKMVAPMSKRRCGVGVAVLNDLLYAVGGH-----DG 379
            |..::.:||.. .|.:.:||...|.|::.|:....:.........:||:..:|..|.:     |.
plant   114 GSDIYNIGGSIYLGPSSSSVSILDSQSHMWREAPSLRVELMSHSASVLDRKIYVAGSYKDGNGDS 178

  Fly   380 QSYLNSIERYDPQTNQWSCDVAPTTSCRTSVGV-----AVLDGFLYAVGGQDGVQCLNHVER--- 436
            .|..|..|.:|.:|..|..:..|   |..:.|:     |.:||..             |||.   
plant   179 NSCKNLFEVFDTKTQVWHPEPIP---CSKTKGIFYSKSACIDGKF-------------HVETTHG 227

  Fly   437 --YDPKENKWSKVAPMTTRRLGVAVAVLGGFLYAIGGSDGQCPLNTV---------ERYDPRHNK 490
              |..||.:|.|..|.               ::.:..|...|.:|.|         ..||.:...
plant   228 VVYAYKEGRWDKAIPT---------------MFGMRASYSFCEINNVLFYIHRGVFRWYDTKLRM 277

  Fly   491 WVAVS-----PMSTRRKHLGCAVFNNYIYAV----------GGRDDCMELSSAERYNPLTNTWSP 540
            |..:.     |.......:..|.:...:..:          ||||:.|             .|..
plant   278 WRILKGLLGLPSLPENMFVRLADYGGKMAVLWEEDRPSCGAGGRDEMM-------------IWCA 329

  Fly   541 IVAM 544
            ::|:
plant   330 VIAL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dboNP_524989.2 BTB_POZ_KLHL20_KLEIP 49..176 CDD:349558
PHA03098 69..587 CDD:222983 51/264 (19%)
KELCH repeat 359..403 CDD:276965 11/48 (23%)
KELCH repeat 407..451 CDD:276965 13/53 (25%)
KELCH repeat 454..497 CDD:276965 7/56 (13%)
KELCH repeat 501..545 CDD:276965 8/54 (15%)
KELCH repeat 548..593 CDD:276965
AT5G51250NP_199938.1 F-box 1..46 CDD:279040
KELCH repeat 109..149 CDD:276965 9/34 (26%)
Kelch_2 153..201 CDD:284956 11/47 (23%)
KELCH repeat 153..199 CDD:276965 11/45 (24%)
KELCH repeat 202..244 CDD:276965 14/69 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.