DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbo and AT5G39560

DIOPT Version :9

Sequence 1:NP_524989.2 Gene:dbo / 53556 FlyBaseID:FBgn0040230 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_198772.2 Gene:AT5G39560 / 833952 AraportID:AT5G39560 Length:403 Species:Arabidopsis thaliana


Alignment Length:416 Identity:91/416 - (21%)
Similarity:147/416 - (35%) Gaps:120/416 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 AVMSWLKYNVAERRQHLAQVLQ--HVRLPLLSPKFLVGTVGSDLL--VRSD----EACRDLVDEA 294
            ::|| |.|.:.|  ..||::.:  :..|.|:|..|| ..:.|..|  .||:    |.|.....|:
plant    28 SLMS-LPYEIIE--NILARISKWSYPNLSLVSKSFL-SLLSSPQLYKTRSEIGTTEPCLYFCLES 88

  Fly   295 KNYLLLPQERPLMQGPRTRPRKPTRRGEVLFAVGGWCSGDAIASVERFDPQTNDWKMV-APMSKR 358
            .|: ..||...|...|          .|.|...|                ..:|:.:: .|.|..
plant    89 ANH-SSPQWYTLWMKP----------DETLTGTG----------------TIHDYSLIPLPSSSP 126

  Fly   359 RCGVGVAVLNDLLYAVGGHDGQSYLNSIERYDPQTNQWSCDVAPTTSCRTSVGVAVLDGFLYAVG 423
            ........:...:|.:|||..:|  :|:..:|.::|.|. |....|..|:.....::|..:|.:|
plant   127 VLRTSTVAVGSEIYVIGGHFNRS--SSVRIFDCRSNTWR-DGPNMTVARSDPVAVLIDQRIYVLG 188

  Fly   424 GQDGVQCLNHVERYDPKENKWSKV----APMTTRRLGVAVAVLGGFLYAIGGSDGQCPLNTVERY 484
            |::..:..:..|.:|.|...|..:    |.:..||            |.:..:          ||
plant   189 GREMDESDDWFEVFDIKTQTWRALPSFRAGLELRR------------YIVWPN----------RY 231

  Fly   485 DPRHN------KWVAVSPMSTRRKHLGCAVFNNYIYAVGGRDDCMELSSAERYNPLTNTWSPIVA 543
            .||..      :.:.|:|.:...|....|..|:|                 .|.|..:||..:..
plant   232 FPRLGDSQTAVRLINVNPNALEGKLYVAAQINDY-----------------TYEPKDDTWKVVSK 279

  Fly   544 MTSRRSGVGLAVVNGQLYAVGGFDGSAYLKTIEVYDPETNQWR-------LC--------GCMNY 593
            .:.||..| ..|:...:||.    ...:|:.   ||.|..:||       ||        |....
plant   280 SSIRRVKV-WCVIENVMYAC----HDVFLRW---YDYEDRRWREIQGLEELCYHPTRGFSGAERI 336

  Fly   594 RRLGGGVGVMRAP-QTEN----YMWC 614
            ...||.:.||..| |::.    .:||
plant   337 VNYGGKLVVMWRPVQSDGKDKIEIWC 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dboNP_524989.2 BTB_POZ_KLHL20_KLEIP 49..176 CDD:349558
PHA03098 69..587 CDD:222983 80/374 (21%)
KELCH repeat 359..403 CDD:276965 10/43 (23%)
KELCH repeat 407..451 CDD:276965 10/47 (21%)
KELCH repeat 454..497 CDD:276965 7/48 (15%)
KELCH repeat 501..545 CDD:276965 8/43 (19%)
KELCH repeat 548..593 CDD:276965 14/59 (24%)
AT5G39560NP_198772.2 KELCH repeat 131..168 CDD:276965 10/39 (26%)
Kelch 139..181 CDD:128874 12/44 (27%)
Kelch_1 171..216 CDD:279660 9/44 (20%)
KELCH repeat 172..220 CDD:276965 10/47 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.