DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbo and AT5G28160

DIOPT Version :9

Sequence 1:NP_524989.2 Gene:dbo / 53556 FlyBaseID:FBgn0040230 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_198168.1 Gene:AT5G28160 / 832891 AraportID:AT5G28160 Length:324 Species:Arabidopsis thaliana


Alignment Length:197 Identity:51/197 - (25%)
Similarity:76/197 - (38%) Gaps:44/197 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 ERFDPQTN--------DWKMVAP-MSKRRCGVGVAVLNDLLYAVGGHDGQSYLNSIERYDPQTNQ 395
            :|.||.:|        .:...|| |:..|......|.|..:|.:||......:|..|.:|.:|..
plant   131 QRNDPSSNMFVRNKGDIFLCKAPNMTVARAKASAVVFNGKIYVMGGCMADESVNWGEVFDIKTQT 195

  Fly   396 WSCDVAPTTSCRTSVGVAVLDGF---LYAVGGQ--DGVQCLNHVERYDPKENKWS--KVAPMTTR 453
            |.....|....|.| .:..:|.|   ||....:  |.|        ||||| :|.  |...|..|
plant   196 WEALPDPGPEFRFS-SIRKIDVFQEKLYVRSNEKKDSV--------YDPKE-EWRVVKGLDMLNR 250

  Fly   454 RLG---VAVAVLGGFLYAIGGSDGQCPLNTVERYDPRHNK--WVAVSPMSTRRKHLGCAVFNNYI 513
            .||   :.:...||.|..:.           ::.|..|:|  |.||  ::..::|....|:.|..
plant   251 NLGCGTIEIVHYGGKLLILW-----------DKVDLSHDKDIWCAV--IALEKRHGSDEVWGNIE 302

  Fly   514 YA 515
            :|
plant   303 WA 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dboNP_524989.2 BTB_POZ_KLHL20_KLEIP 49..176 CDD:349558
PHA03098 69..587 CDD:222983 51/197 (26%)
KELCH repeat 359..403 CDD:276965 11/43 (26%)
KELCH repeat 407..451 CDD:276965 15/50 (30%)
KELCH repeat 454..497 CDD:276965 11/47 (23%)
KELCH repeat 501..545 CDD:276965 4/15 (27%)
KELCH repeat 548..593 CDD:276965
AT5G28160NP_198168.1 F-box 8..55 CDD:279040
Kelch_1 158..203 CDD:279660 11/44 (25%)
KELCH repeat 159..202 CDD:276965 11/42 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.